Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JS51

Protein Details
Accession A0A2H3JS51    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
156-189ATARVIRHSRKPQPRTPQRIKRKGGQRRIVAKATHydrophilic
NLS Segment(s)
PositionSequence
28-42KGGPTRGGSPLRSRP
160-189VIRHSRKPQPRTPQRIKRKGGQRRIVAKAT
Subcellular Location(s) mito 14, extr 5, nucl 4.5, cyto_nucl 4.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAAPPALPTAPLDWTTPSCTLLRAPTRKGGPTRGGSPLRSRPSFGQRRKHLGSQHNGAHRYSPSAHGGTIRLNNWDLRRCSGLTTKHLRLSVDPRGNPARAPIERGAASATDKTRAAPQGLLDIRVQTRTPPDSSGSDKAIPANGIAPAEGQTARATARVIRHSRKPQPRTPQRIKRKGGQRRIVAKATRRTTESNSGAAALPNAPPFPPTAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.24
4 0.24
5 0.22
6 0.21
7 0.23
8 0.28
9 0.35
10 0.37
11 0.4
12 0.45
13 0.49
14 0.54
15 0.56
16 0.55
17 0.53
18 0.52
19 0.52
20 0.53
21 0.53
22 0.49
23 0.52
24 0.54
25 0.55
26 0.51
27 0.5
28 0.48
29 0.55
30 0.62
31 0.63
32 0.64
33 0.64
34 0.71
35 0.73
36 0.73
37 0.71
38 0.69
39 0.68
40 0.65
41 0.63
42 0.61
43 0.58
44 0.52
45 0.47
46 0.39
47 0.35
48 0.29
49 0.26
50 0.22
51 0.21
52 0.22
53 0.2
54 0.2
55 0.2
56 0.23
57 0.2
58 0.19
59 0.19
60 0.22
61 0.24
62 0.29
63 0.27
64 0.25
65 0.27
66 0.26
67 0.27
68 0.3
69 0.31
70 0.32
71 0.38
72 0.39
73 0.39
74 0.4
75 0.38
76 0.35
77 0.36
78 0.38
79 0.37
80 0.34
81 0.35
82 0.36
83 0.36
84 0.33
85 0.3
86 0.27
87 0.21
88 0.25
89 0.22
90 0.21
91 0.21
92 0.21
93 0.19
94 0.13
95 0.14
96 0.12
97 0.12
98 0.11
99 0.11
100 0.11
101 0.14
102 0.15
103 0.15
104 0.13
105 0.13
106 0.18
107 0.19
108 0.2
109 0.17
110 0.17
111 0.17
112 0.17
113 0.17
114 0.11
115 0.15
116 0.16
117 0.17
118 0.17
119 0.19
120 0.21
121 0.26
122 0.27
123 0.26
124 0.25
125 0.24
126 0.23
127 0.22
128 0.19
129 0.14
130 0.12
131 0.1
132 0.09
133 0.08
134 0.08
135 0.07
136 0.09
137 0.09
138 0.08
139 0.08
140 0.09
141 0.09
142 0.09
143 0.09
144 0.11
145 0.16
146 0.24
147 0.31
148 0.36
149 0.45
150 0.54
151 0.64
152 0.72
153 0.74
154 0.75
155 0.79
156 0.84
157 0.86
158 0.87
159 0.87
160 0.88
161 0.91
162 0.87
163 0.85
164 0.85
165 0.85
166 0.85
167 0.83
168 0.82
169 0.8
170 0.81
171 0.8
172 0.76
173 0.74
174 0.73
175 0.7
176 0.65
177 0.6
178 0.58
179 0.57
180 0.59
181 0.54
182 0.46
183 0.4
184 0.38
185 0.35
186 0.3
187 0.25
188 0.16
189 0.15
190 0.15
191 0.15
192 0.14
193 0.14