Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JHV6

Protein Details
Accession A0A2H3JHV6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MHIKKLKVRPRKERAQAICGHydrophilic
NLS Segment(s)
PositionSequence
9-10RP
Subcellular Location(s) mito 20, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MHIKKLKVRPRKERAQAICGAPLAAMLGCWAASGDIHSAGPCRDAAQALYECMRTTPAGRKSQGTTINYHLMRLGKILNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.75
4 0.66
5 0.59
6 0.48
7 0.39
8 0.28
9 0.21
10 0.15
11 0.09
12 0.06
13 0.04
14 0.04
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.04
21 0.04
22 0.05
23 0.05
24 0.05
25 0.06
26 0.06
27 0.07
28 0.06
29 0.07
30 0.06
31 0.07
32 0.07
33 0.1
34 0.11
35 0.11
36 0.12
37 0.12
38 0.11
39 0.11
40 0.12
41 0.09
42 0.11
43 0.19
44 0.26
45 0.32
46 0.34
47 0.38
48 0.4
49 0.46
50 0.51
51 0.45
52 0.41
53 0.39
54 0.46
55 0.43
56 0.4
57 0.36
58 0.3
59 0.28
60 0.26