Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3J7Z7

Protein Details
Accession A0A2H3J7Z7    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRKPATPASRKREPLBasic
NLS Segment(s)
PositionSequence
3-19KRKKSSRKPATPASRKR
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPATPASRKREPLDTTFTCLFCHHQQSVTVKIDRKEGIAQLFCRVCDQRYQSRVNHLTEPIDIYSEWIDAADAAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.84
4 0.78
5 0.74
6 0.72
7 0.64
8 0.58
9 0.57
10 0.51
11 0.47
12 0.45
13 0.42
14 0.34
15 0.31
16 0.3
17 0.25
18 0.28
19 0.23
20 0.21
21 0.25
22 0.27
23 0.32
24 0.32
25 0.32
26 0.3
27 0.3
28 0.32
29 0.28
30 0.27
31 0.22
32 0.2
33 0.2
34 0.2
35 0.2
36 0.21
37 0.21
38 0.2
39 0.21
40 0.2
41 0.18
42 0.21
43 0.26
44 0.3
45 0.36
46 0.41
47 0.4
48 0.49
49 0.53
50 0.51
51 0.49
52 0.42
53 0.38
54 0.34
55 0.34
56 0.24
57 0.21
58 0.17
59 0.15
60 0.14
61 0.13
62 0.12
63 0.09
64 0.08
65 0.07