Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3K7D8

Protein Details
Accession A0A2H3K7D8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
79-100RCPAPPSPRRLQPPRSSRPRDRBasic
NLS Segment(s)
PositionSequence
88-99RLQPPRSSRPRD
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MGQQMLRRFLVAARGGSRSSATRKLPLRYKWRCRLLVPVIGRAPQIARSLSSNTLPSTTLPALSALPACPAPPPRLLPRCPAPPSPRRLQPPRSSRPRDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.26
4 0.26
5 0.23
6 0.25
7 0.29
8 0.29
9 0.34
10 0.39
11 0.46
12 0.53
13 0.57
14 0.63
15 0.66
16 0.73
17 0.76
18 0.79
19 0.75
20 0.68
21 0.68
22 0.62
23 0.6
24 0.51
25 0.47
26 0.4
27 0.37
28 0.35
29 0.26
30 0.22
31 0.17
32 0.17
33 0.12
34 0.11
35 0.12
36 0.14
37 0.15
38 0.16
39 0.14
40 0.13
41 0.13
42 0.13
43 0.11
44 0.14
45 0.12
46 0.12
47 0.11
48 0.11
49 0.1
50 0.1
51 0.11
52 0.07
53 0.08
54 0.08
55 0.08
56 0.09
57 0.12
58 0.14
59 0.17
60 0.21
61 0.29
62 0.36
63 0.39
64 0.43
65 0.47
66 0.54
67 0.55
68 0.59
69 0.58
70 0.59
71 0.65
72 0.66
73 0.68
74 0.69
75 0.73
76 0.75
77 0.77
78 0.79
79 0.82
80 0.85