Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8C0K8

Protein Details
Accession G8C0K8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAGPREIKKRTHRRKKDPNAPKRAMSBasic
NLS Segment(s)
PositionSequence
5-23REIKKRTHRRKKDPNAPKR
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG tpf:TPHA_0M01480  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAGPREIKKRTHRRKKDPNAPKRAMSAYMFFANETRDIVRAENPDVSFGQIGRLLGEKWRALTDEDKGPFEAKAQADKKRYESEKELYNATKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.96
3 0.96
4 0.95
5 0.95
6 0.94
7 0.88
8 0.79
9 0.72
10 0.63
11 0.56
12 0.47
13 0.38
14 0.31
15 0.28
16 0.25
17 0.21
18 0.19
19 0.16
20 0.15
21 0.13
22 0.11
23 0.1
24 0.1
25 0.11
26 0.14
27 0.14
28 0.15
29 0.17
30 0.17
31 0.17
32 0.16
33 0.16
34 0.13
35 0.11
36 0.1
37 0.08
38 0.08
39 0.07
40 0.08
41 0.07
42 0.09
43 0.12
44 0.11
45 0.11
46 0.12
47 0.13
48 0.14
49 0.16
50 0.18
51 0.22
52 0.24
53 0.24
54 0.24
55 0.24
56 0.22
57 0.21
58 0.23
59 0.18
60 0.25
61 0.29
62 0.36
63 0.41
64 0.45
65 0.48
66 0.52
67 0.55
68 0.53
69 0.54
70 0.52
71 0.54
72 0.53
73 0.54