Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BP33

Protein Details
Accession G8BP33    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MDPFSLKRENRKKFQDKQKLKRSHPTSSARKYRIHydrophilic
NLS Segment(s)
PositionSequence
8-25RENRKKFQDKQKLKRSHP
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR035303  DUF5364  
KEGG tpf:TPHA_0A05870  -  
Pfam View protein in Pfam  
PF17322  DUF5364  
Amino Acid Sequences MDPFSLKRENRKKFQDKQKLKRSHPTSSARKYRILNRQKQAEEDNTKGENGEDETIKEAPNNLDRYDKEDESAFDDLEDTLVSTVATNKLKEVIKAKEQNNITADRELQISSNKVKTTRDLASMDIKELNTMLQRTTLNNNIPSQESTTNKYSVISKAEKSPIEPNTVKKTRPTHESLVPPTLNKDEDFLDGLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.9
4 0.91
5 0.92
6 0.92
7 0.89
8 0.89
9 0.84
10 0.82
11 0.8
12 0.79
13 0.79
14 0.79
15 0.82
16 0.75
17 0.75
18 0.71
19 0.71
20 0.71
21 0.72
22 0.71
23 0.69
24 0.75
25 0.7
26 0.69
27 0.66
28 0.64
29 0.6
30 0.52
31 0.48
32 0.4
33 0.38
34 0.34
35 0.28
36 0.2
37 0.16
38 0.16
39 0.12
40 0.11
41 0.14
42 0.14
43 0.14
44 0.13
45 0.13
46 0.13
47 0.19
48 0.2
49 0.19
50 0.23
51 0.23
52 0.29
53 0.32
54 0.3
55 0.25
56 0.24
57 0.23
58 0.22
59 0.23
60 0.17
61 0.11
62 0.12
63 0.1
64 0.09
65 0.08
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.09
73 0.1
74 0.1
75 0.1
76 0.15
77 0.16
78 0.18
79 0.22
80 0.21
81 0.28
82 0.35
83 0.36
84 0.38
85 0.38
86 0.39
87 0.36
88 0.35
89 0.29
90 0.22
91 0.22
92 0.16
93 0.16
94 0.13
95 0.12
96 0.11
97 0.12
98 0.14
99 0.16
100 0.17
101 0.18
102 0.18
103 0.2
104 0.24
105 0.23
106 0.25
107 0.23
108 0.24
109 0.29
110 0.29
111 0.27
112 0.24
113 0.22
114 0.17
115 0.16
116 0.15
117 0.11
118 0.11
119 0.1
120 0.11
121 0.12
122 0.14
123 0.19
124 0.23
125 0.25
126 0.27
127 0.28
128 0.27
129 0.28
130 0.28
131 0.27
132 0.27
133 0.26
134 0.28
135 0.3
136 0.29
137 0.27
138 0.27
139 0.26
140 0.24
141 0.28
142 0.27
143 0.26
144 0.31
145 0.37
146 0.36
147 0.37
148 0.41
149 0.37
150 0.42
151 0.43
152 0.43
153 0.47
154 0.52
155 0.5
156 0.51
157 0.56
158 0.54
159 0.58
160 0.58
161 0.54
162 0.57
163 0.64
164 0.61
165 0.61
166 0.57
167 0.5
168 0.48
169 0.45
170 0.4
171 0.32
172 0.28
173 0.22
174 0.23