Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3IFV3

Protein Details
Accession A0A2H3IFV3    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
94-120EDAPKGKKGKKGKKGTKGKKGAKKVADBasic
158-190VEDKAKGKKGKKGKKGTKGKKGGKKGAKKVAEDBasic
NLS Segment(s)
PositionSequence
64-73AKKAAAKGPK
97-117PKGKKGKKGKKGTKGKKGAKK
161-186KAKGKKGKKGKKGTKGKKGGKKGAKK
Subcellular Location(s) cyto 13.5, cyto_mito 10.5, mito 6.5, nucl 2, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences MHVAVSKAFILSLLASNALAFRSGNDGNELEKKYVGSVSTLASRWAQLSAPLEARHHTEARIAAKKAAAKGPKHIGRAVQAAGDESGAQENVVEDAPKGKKGKKGKKGTKGKKGAKKVADAEVTKRDVLPEGDDEDLEAGELDSRSTGGAVDAQEDVVEDKAKGKKGKKGKKGTKGKKGGKKGAKKVAEDGQAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.1
5 0.09
6 0.09
7 0.07
8 0.07
9 0.12
10 0.13
11 0.14
12 0.17
13 0.17
14 0.2
15 0.26
16 0.28
17 0.23
18 0.23
19 0.22
20 0.2
21 0.21
22 0.18
23 0.13
24 0.12
25 0.13
26 0.16
27 0.16
28 0.17
29 0.15
30 0.16
31 0.15
32 0.14
33 0.13
34 0.12
35 0.14
36 0.16
37 0.18
38 0.19
39 0.19
40 0.19
41 0.23
42 0.23
43 0.22
44 0.19
45 0.19
46 0.22
47 0.28
48 0.32
49 0.29
50 0.27
51 0.29
52 0.31
53 0.3
54 0.33
55 0.32
56 0.27
57 0.32
58 0.4
59 0.43
60 0.42
61 0.41
62 0.37
63 0.34
64 0.35
65 0.3
66 0.21
67 0.16
68 0.14
69 0.13
70 0.11
71 0.08
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.08
83 0.09
84 0.13
85 0.15
86 0.18
87 0.25
88 0.35
89 0.45
90 0.51
91 0.62
92 0.68
93 0.76
94 0.84
95 0.87
96 0.88
97 0.88
98 0.87
99 0.85
100 0.84
101 0.82
102 0.74
103 0.7
104 0.63
105 0.58
106 0.54
107 0.46
108 0.41
109 0.38
110 0.36
111 0.31
112 0.28
113 0.22
114 0.18
115 0.18
116 0.16
117 0.13
118 0.13
119 0.13
120 0.13
121 0.13
122 0.11
123 0.1
124 0.08
125 0.06
126 0.04
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.04
136 0.07
137 0.07
138 0.08
139 0.09
140 0.08
141 0.08
142 0.08
143 0.09
144 0.08
145 0.08
146 0.07
147 0.13
148 0.17
149 0.24
150 0.31
151 0.35
152 0.43
153 0.54
154 0.64
155 0.69
156 0.76
157 0.79
158 0.82
159 0.88
160 0.89
161 0.89
162 0.9
163 0.89
164 0.89
165 0.89
166 0.9
167 0.89
168 0.9
169 0.89
170 0.88
171 0.85
172 0.78
173 0.74
174 0.72