Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BY21

Protein Details
Accession G8BY21   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
74-95VEKEDKTSKKRNAIRTRLQVINHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 14.333, cyto 7, cyto_pero 4.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR033775  DUF5137  
KEGG tpf:TPHA_0I02980  -  
Pfam View protein in Pfam  
PF17220  DUF5137  
Amino Acid Sequences MNDAEDPYDWYYHNQKENKPENELKKTINDLNSASAQETYQRSLPKEVYPELKPIPNNTASANGVRRQIEAYDVEKEDKTSKKRNAIRTRLQVINPPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.54
4 0.63
5 0.63
6 0.63
7 0.65
8 0.65
9 0.67
10 0.65
11 0.57
12 0.51
13 0.52
14 0.48
15 0.42
16 0.36
17 0.29
18 0.29
19 0.28
20 0.24
21 0.2
22 0.16
23 0.13
24 0.15
25 0.15
26 0.14
27 0.16
28 0.17
29 0.18
30 0.21
31 0.22
32 0.2
33 0.22
34 0.22
35 0.24
36 0.23
37 0.25
38 0.24
39 0.25
40 0.24
41 0.23
42 0.25
43 0.22
44 0.22
45 0.19
46 0.21
47 0.19
48 0.21
49 0.22
50 0.21
51 0.23
52 0.23
53 0.22
54 0.2
55 0.19
56 0.18
57 0.19
58 0.19
59 0.19
60 0.2
61 0.22
62 0.21
63 0.23
64 0.26
65 0.3
66 0.35
67 0.4
68 0.47
69 0.55
70 0.62
71 0.71
72 0.77
73 0.79
74 0.83
75 0.83
76 0.82
77 0.78
78 0.73