Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3IQB3

Protein Details
Accession A0A2H3IQB3   
Localization Confidence Low
Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
28-49RLKLDPRCSVRNRKREIERLPEBasic
NLS Segment(s)
Subcellular Location(s) mito 11.5, cyto_mito 10, cyto 7.5, nucl 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012110  PDC/IPDC-like  
IPR029061  THDP-binding  
IPR011766  TPP_enzyme_TPP-bd  
IPR047214  TPP_PDC_IPDC  
Gene Ontology GO:0016831  F:carboxy-lyase activity  
GO:0030976  F:thiamine pyrophosphate binding  
Pfam View protein in Pfam  
PF02775  TPP_enzyme_C  
CDD cd02005  TPP_PDC_IPDC  
Amino Acid Sequences MAKIYGYSGVSVLSKLARSGGYPNWPERLKLDPRCSVRNRKREIERLPEPCAEAVIYQDSFWFRISKSFQPGDVILTETGTASSGGNDFVLPRHATMINSAAWLSIRYALGACVGATLVRMEWEKWRSEHPGEFIKGRTILFEGDGSFQMTAQAVSDISRNWLDVIIFLISNDEYTIERVINSMNADYNDVQPWNYFESGSYFGAPKDDPSYPVFAKRANNWGELFEIIEDPQLKAGKGFSMVEVMMRKDDAVASLKELVHLAKQQNRAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.13
5 0.14
6 0.18
7 0.22
8 0.29
9 0.33
10 0.36
11 0.41
12 0.41
13 0.41
14 0.39
15 0.42
16 0.43
17 0.48
18 0.52
19 0.53
20 0.58
21 0.66
22 0.72
23 0.75
24 0.75
25 0.76
26 0.76
27 0.77
28 0.81
29 0.81
30 0.81
31 0.79
32 0.78
33 0.73
34 0.71
35 0.63
36 0.56
37 0.46
38 0.38
39 0.29
40 0.2
41 0.16
42 0.15
43 0.13
44 0.11
45 0.13
46 0.13
47 0.14
48 0.15
49 0.14
50 0.11
51 0.18
52 0.23
53 0.26
54 0.33
55 0.34
56 0.33
57 0.34
58 0.35
59 0.3
60 0.26
61 0.22
62 0.14
63 0.13
64 0.12
65 0.09
66 0.09
67 0.07
68 0.07
69 0.05
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.09
78 0.09
79 0.09
80 0.11
81 0.12
82 0.12
83 0.13
84 0.15
85 0.12
86 0.12
87 0.12
88 0.09
89 0.09
90 0.09
91 0.08
92 0.08
93 0.08
94 0.07
95 0.08
96 0.07
97 0.08
98 0.07
99 0.07
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.03
106 0.04
107 0.05
108 0.06
109 0.11
110 0.13
111 0.15
112 0.16
113 0.19
114 0.22
115 0.25
116 0.26
117 0.24
118 0.27
119 0.27
120 0.27
121 0.25
122 0.22
123 0.2
124 0.18
125 0.16
126 0.11
127 0.1
128 0.09
129 0.09
130 0.08
131 0.08
132 0.09
133 0.08
134 0.08
135 0.07
136 0.07
137 0.07
138 0.06
139 0.05
140 0.05
141 0.04
142 0.05
143 0.06
144 0.05
145 0.07
146 0.08
147 0.08
148 0.08
149 0.08
150 0.08
151 0.07
152 0.08
153 0.07
154 0.06
155 0.06
156 0.07
157 0.06
158 0.06
159 0.06
160 0.05
161 0.05
162 0.06
163 0.08
164 0.07
165 0.07
166 0.07
167 0.08
168 0.08
169 0.09
170 0.08
171 0.09
172 0.1
173 0.12
174 0.13
175 0.14
176 0.14
177 0.14
178 0.14
179 0.12
180 0.14
181 0.14
182 0.14
183 0.12
184 0.11
185 0.14
186 0.17
187 0.18
188 0.17
189 0.14
190 0.14
191 0.16
192 0.16
193 0.14
194 0.15
195 0.15
196 0.17
197 0.18
198 0.24
199 0.23
200 0.29
201 0.28
202 0.28
203 0.32
204 0.34
205 0.4
206 0.37
207 0.4
208 0.35
209 0.35
210 0.32
211 0.28
212 0.24
213 0.17
214 0.14
215 0.11
216 0.13
217 0.13
218 0.11
219 0.15
220 0.16
221 0.15
222 0.15
223 0.16
224 0.14
225 0.16
226 0.17
227 0.13
228 0.14
229 0.14
230 0.17
231 0.19
232 0.19
233 0.17
234 0.17
235 0.16
236 0.14
237 0.15
238 0.14
239 0.16
240 0.15
241 0.17
242 0.21
243 0.21
244 0.21
245 0.22
246 0.2
247 0.2
248 0.26
249 0.3
250 0.33