Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BV97

Protein Details
Accession G8BV97    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
84-105FGWGNKTRLRVKKQQKSFEKAVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, nucl 11, cyto 11, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
KEGG tpf:TPHA_0F01970  -  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MFEFVNELIAGFSYEKFMRLVIILGGYILIRNLAQRELAKRKLSAQLRDDRKFKSEKNTEQYLEDPKEEEKKEKELEEAAASSFGWGNKTRLRVKKQQKSFEKAVDRLQQQQQNALSIEDEDADIQELLED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.12
5 0.12
6 0.11
7 0.12
8 0.09
9 0.09
10 0.08
11 0.07
12 0.07
13 0.06
14 0.06
15 0.05
16 0.04
17 0.04
18 0.06
19 0.07
20 0.07
21 0.1
22 0.13
23 0.21
24 0.28
25 0.34
26 0.35
27 0.35
28 0.38
29 0.44
30 0.47
31 0.46
32 0.46
33 0.49
34 0.55
35 0.6
36 0.59
37 0.53
38 0.51
39 0.49
40 0.44
41 0.46
42 0.46
43 0.48
44 0.51
45 0.54
46 0.51
47 0.47
48 0.47
49 0.43
50 0.36
51 0.28
52 0.23
53 0.19
54 0.24
55 0.23
56 0.25
57 0.22
58 0.25
59 0.27
60 0.27
61 0.26
62 0.22
63 0.22
64 0.19
65 0.17
66 0.12
67 0.11
68 0.1
69 0.09
70 0.09
71 0.08
72 0.09
73 0.1
74 0.13
75 0.16
76 0.23
77 0.31
78 0.38
79 0.45
80 0.53
81 0.63
82 0.7
83 0.76
84 0.8
85 0.81
86 0.8
87 0.79
88 0.78
89 0.74
90 0.67
91 0.65
92 0.63
93 0.57
94 0.56
95 0.58
96 0.54
97 0.48
98 0.51
99 0.44
100 0.4
101 0.38
102 0.31
103 0.24
104 0.19
105 0.19
106 0.13
107 0.12
108 0.09
109 0.08
110 0.09
111 0.09