Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3ILU8

Protein Details
Accession A0A2H3ILU8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
194-219AYDRAMKEKEIKRRNKEKEAAAKARQHydrophilic
NLS Segment(s)
PositionSequence
63-75KGGKEKKGATKKK
197-219RAMKEKEIKRRNKEKEAAAKARQ
Subcellular Location(s) mito 11.5, cyto_mito 9, nucl 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MMPLHQKAKPKANTLDGHIGACSYITASLEKSLEELNIQNRKPEPDISRLSLSAADTTTTSAKGGKEKKGATKKKAAVADSWEDELSDDEEVASTTETEKENDTKAKLKSSLAATKSEGPLAPPSTPSTHYDGDDYGLPQWGRVPSTNTTSPLASGRDRDGAHARPEKQTAVASRLIAGALGIRAPKRTEEQRAYDRAMKEKEIKRRNKEKEAAAKARQEEERAKAAVWDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.64
3 0.55
4 0.49
5 0.41
6 0.34
7 0.26
8 0.22
9 0.15
10 0.07
11 0.06
12 0.07
13 0.08
14 0.09
15 0.12
16 0.12
17 0.12
18 0.13
19 0.13
20 0.12
21 0.13
22 0.15
23 0.21
24 0.28
25 0.29
26 0.32
27 0.34
28 0.37
29 0.38
30 0.42
31 0.38
32 0.38
33 0.43
34 0.42
35 0.43
36 0.39
37 0.37
38 0.32
39 0.28
40 0.22
41 0.17
42 0.13
43 0.1
44 0.12
45 0.12
46 0.1
47 0.1
48 0.11
49 0.12
50 0.2
51 0.25
52 0.3
53 0.35
54 0.39
55 0.48
56 0.57
57 0.64
58 0.63
59 0.67
60 0.65
61 0.65
62 0.66
63 0.58
64 0.49
65 0.45
66 0.43
67 0.35
68 0.31
69 0.24
70 0.2
71 0.18
72 0.17
73 0.12
74 0.08
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.04
82 0.04
83 0.07
84 0.08
85 0.08
86 0.1
87 0.11
88 0.13
89 0.16
90 0.17
91 0.21
92 0.21
93 0.24
94 0.24
95 0.23
96 0.24
97 0.27
98 0.31
99 0.27
100 0.27
101 0.25
102 0.27
103 0.26
104 0.24
105 0.19
106 0.14
107 0.15
108 0.15
109 0.14
110 0.12
111 0.13
112 0.14
113 0.17
114 0.18
115 0.2
116 0.2
117 0.2
118 0.2
119 0.18
120 0.17
121 0.16
122 0.14
123 0.1
124 0.11
125 0.11
126 0.1
127 0.12
128 0.12
129 0.13
130 0.14
131 0.17
132 0.16
133 0.22
134 0.24
135 0.24
136 0.24
137 0.23
138 0.22
139 0.21
140 0.21
141 0.17
142 0.17
143 0.17
144 0.21
145 0.21
146 0.23
147 0.26
148 0.27
149 0.33
150 0.38
151 0.38
152 0.37
153 0.39
154 0.36
155 0.33
156 0.33
157 0.28
158 0.26
159 0.26
160 0.22
161 0.21
162 0.2
163 0.18
164 0.14
165 0.11
166 0.08
167 0.06
168 0.07
169 0.08
170 0.09
171 0.11
172 0.12
173 0.15
174 0.21
175 0.27
176 0.36
177 0.41
178 0.48
179 0.54
180 0.58
181 0.6
182 0.6
183 0.56
184 0.55
185 0.52
186 0.49
187 0.51
188 0.53
189 0.59
190 0.62
191 0.7
192 0.72
193 0.8
194 0.84
195 0.85
196 0.85
197 0.85
198 0.85
199 0.85
200 0.84
201 0.79
202 0.77
203 0.7
204 0.69
205 0.62
206 0.57
207 0.52
208 0.49
209 0.48
210 0.42
211 0.39