Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3J1U0

Protein Details
Accession A0A2H3J1U0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
134-155KEAPEPSRKRLKPNRSERYTIHBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002052  DNA_methylase_N6_adenine_CS  
IPR007757  MT-A70-like  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0003676  F:nucleic acid binding  
GO:0043414  P:macromolecule methylation  
GO:0090304  P:nucleic acid metabolic process  
Pfam View protein in Pfam  
PF05063  MT-A70  
PROSITE View protein in PROSITE  
PS51143  MT_A70  
PS00092  N6_MTASE  
Amino Acid Sequences MPNRSSILYQNSQQSVFLLDIPASIEIAQTALSYSSSSLHADDNAQSYRYRRVFSSNPLEQPYPSPPEPKSEAARARLLSRIPESEILFHESISALIRNGVDEIRHGLSGEVKWCAPRRVHSGAIDSRTVDEQKEAPEPSRKRLKPNRSERYTIHTENQPPLILSPSSVNEFAGLTDLHGIQVKNRSPLEAATLQVEEPGTGATTRYTVPPASAFILSNLSASQPYSDSNTPPIPGLPSTEKFNVILFDPPWPNRSVRRSSQYPTHGYLEMISLVSIMQQTILSHLNFGDDNTMVGIWTTNNAKSRQAAYDAFRKTGLEIFEIWIWIKITKNGGLVSPLDGLWRKPYEILFLGRQKLDTEDGKEPIKRIIAAVPDEHSRKPNLKELIELLFFQNKGNEARDTPTNIKEYTALEVFARNLTAGWCACGNDVLKFNADQWWYRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.29
3 0.25
4 0.22
5 0.15
6 0.12
7 0.11
8 0.12
9 0.12
10 0.1
11 0.09
12 0.08
13 0.07
14 0.07
15 0.07
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.08
22 0.09
23 0.11
24 0.12
25 0.12
26 0.13
27 0.14
28 0.16
29 0.18
30 0.21
31 0.21
32 0.21
33 0.22
34 0.23
35 0.32
36 0.33
37 0.33
38 0.3
39 0.36
40 0.4
41 0.48
42 0.55
43 0.52
44 0.54
45 0.57
46 0.56
47 0.49
48 0.48
49 0.44
50 0.42
51 0.37
52 0.37
53 0.33
54 0.39
55 0.43
56 0.44
57 0.43
58 0.45
59 0.49
60 0.48
61 0.52
62 0.47
63 0.44
64 0.43
65 0.39
66 0.35
67 0.32
68 0.3
69 0.27
70 0.3
71 0.28
72 0.27
73 0.28
74 0.29
75 0.25
76 0.22
77 0.2
78 0.16
79 0.16
80 0.15
81 0.13
82 0.08
83 0.1
84 0.1
85 0.1
86 0.11
87 0.11
88 0.09
89 0.09
90 0.13
91 0.13
92 0.13
93 0.13
94 0.12
95 0.14
96 0.16
97 0.17
98 0.15
99 0.14
100 0.19
101 0.23
102 0.27
103 0.27
104 0.3
105 0.35
106 0.39
107 0.43
108 0.4
109 0.44
110 0.44
111 0.45
112 0.4
113 0.33
114 0.29
115 0.28
116 0.26
117 0.19
118 0.16
119 0.15
120 0.16
121 0.2
122 0.2
123 0.21
124 0.29
125 0.31
126 0.38
127 0.47
128 0.47
129 0.53
130 0.62
131 0.7
132 0.71
133 0.8
134 0.82
135 0.78
136 0.8
137 0.72
138 0.7
139 0.66
140 0.59
141 0.52
142 0.47
143 0.45
144 0.42
145 0.41
146 0.33
147 0.26
148 0.23
149 0.21
150 0.15
151 0.12
152 0.12
153 0.11
154 0.13
155 0.13
156 0.12
157 0.1
158 0.1
159 0.1
160 0.09
161 0.07
162 0.06
163 0.07
164 0.07
165 0.07
166 0.09
167 0.09
168 0.1
169 0.17
170 0.18
171 0.22
172 0.22
173 0.22
174 0.21
175 0.21
176 0.24
177 0.18
178 0.17
179 0.14
180 0.14
181 0.13
182 0.13
183 0.13
184 0.07
185 0.06
186 0.06
187 0.04
188 0.04
189 0.05
190 0.04
191 0.05
192 0.06
193 0.07
194 0.08
195 0.08
196 0.08
197 0.09
198 0.1
199 0.1
200 0.11
201 0.1
202 0.09
203 0.11
204 0.1
205 0.1
206 0.08
207 0.07
208 0.07
209 0.07
210 0.06
211 0.05
212 0.06
213 0.1
214 0.11
215 0.11
216 0.14
217 0.15
218 0.15
219 0.14
220 0.14
221 0.12
222 0.11
223 0.13
224 0.14
225 0.15
226 0.18
227 0.19
228 0.2
229 0.19
230 0.19
231 0.17
232 0.13
233 0.14
234 0.11
235 0.14
236 0.16
237 0.17
238 0.18
239 0.19
240 0.21
241 0.24
242 0.31
243 0.32
244 0.36
245 0.42
246 0.45
247 0.46
248 0.52
249 0.52
250 0.5
251 0.47
252 0.44
253 0.37
254 0.33
255 0.3
256 0.22
257 0.17
258 0.13
259 0.09
260 0.06
261 0.05
262 0.06
263 0.05
264 0.04
265 0.04
266 0.04
267 0.04
268 0.07
269 0.1
270 0.09
271 0.09
272 0.1
273 0.1
274 0.1
275 0.1
276 0.1
277 0.07
278 0.07
279 0.07
280 0.07
281 0.06
282 0.06
283 0.06
284 0.04
285 0.06
286 0.08
287 0.11
288 0.16
289 0.17
290 0.19
291 0.21
292 0.24
293 0.24
294 0.26
295 0.27
296 0.26
297 0.34
298 0.34
299 0.32
300 0.3
301 0.28
302 0.25
303 0.25
304 0.22
305 0.15
306 0.14
307 0.15
308 0.15
309 0.15
310 0.15
311 0.13
312 0.12
313 0.12
314 0.12
315 0.14
316 0.16
317 0.18
318 0.2
319 0.19
320 0.19
321 0.19
322 0.19
323 0.18
324 0.16
325 0.13
326 0.14
327 0.15
328 0.15
329 0.19
330 0.2
331 0.19
332 0.2
333 0.2
334 0.22
335 0.25
336 0.28
337 0.29
338 0.33
339 0.37
340 0.35
341 0.35
342 0.31
343 0.3
344 0.31
345 0.27
346 0.27
347 0.28
348 0.3
349 0.34
350 0.35
351 0.34
352 0.33
353 0.31
354 0.26
355 0.23
356 0.24
357 0.25
358 0.26
359 0.26
360 0.25
361 0.29
362 0.32
363 0.33
364 0.31
365 0.32
366 0.36
367 0.38
368 0.44
369 0.45
370 0.43
371 0.45
372 0.45
373 0.45
374 0.4
375 0.37
376 0.31
377 0.29
378 0.28
379 0.25
380 0.24
381 0.21
382 0.23
383 0.25
384 0.25
385 0.22
386 0.26
387 0.3
388 0.35
389 0.37
390 0.39
391 0.4
392 0.37
393 0.37
394 0.35
395 0.32
396 0.3
397 0.26
398 0.22
399 0.19
400 0.2
401 0.2
402 0.19
403 0.18
404 0.12
405 0.12
406 0.11
407 0.15
408 0.13
409 0.14
410 0.14
411 0.15
412 0.15
413 0.19
414 0.2
415 0.2
416 0.23
417 0.22
418 0.23
419 0.23
420 0.24
421 0.26
422 0.28