Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BXG9

Protein Details
Accession G8BXG9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
122-149KTKRAFQVREVTKRRNRKVRHATSKADLHydrophilic
NLS Segment(s)
PositionSequence
134-139KRRNRK
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
KEGG tpf:TPHA_0I00910  -  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MFSRNIQKIVPLTRTSFTPTLLKVTSLRNFSCSSIWNRAVQQNDLAPLKLANELYAVFKVHERPYLVTEGDIVTLPFRMKEADVGDTLILNDVTTLGSRNFKLIDKPIDPKFYSLKAVVVEKTKRAFQVREVTKRRNRKVRHATSKADLTVIRISELAIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.35
4 0.31
5 0.3
6 0.28
7 0.29
8 0.28
9 0.29
10 0.25
11 0.31
12 0.34
13 0.34
14 0.34
15 0.32
16 0.33
17 0.33
18 0.32
19 0.29
20 0.29
21 0.32
22 0.34
23 0.34
24 0.35
25 0.38
26 0.39
27 0.36
28 0.33
29 0.26
30 0.28
31 0.26
32 0.22
33 0.18
34 0.16
35 0.15
36 0.15
37 0.13
38 0.09
39 0.09
40 0.09
41 0.1
42 0.11
43 0.11
44 0.09
45 0.1
46 0.14
47 0.14
48 0.17
49 0.17
50 0.18
51 0.19
52 0.21
53 0.2
54 0.16
55 0.15
56 0.13
57 0.12
58 0.1
59 0.08
60 0.05
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.08
68 0.09
69 0.1
70 0.1
71 0.1
72 0.1
73 0.09
74 0.09
75 0.07
76 0.06
77 0.04
78 0.04
79 0.03
80 0.04
81 0.04
82 0.05
83 0.06
84 0.08
85 0.09
86 0.1
87 0.11
88 0.12
89 0.15
90 0.19
91 0.24
92 0.25
93 0.31
94 0.34
95 0.38
96 0.38
97 0.37
98 0.36
99 0.32
100 0.32
101 0.27
102 0.25
103 0.21
104 0.23
105 0.23
106 0.27
107 0.27
108 0.28
109 0.3
110 0.31
111 0.33
112 0.36
113 0.35
114 0.35
115 0.43
116 0.48
117 0.56
118 0.61
119 0.66
120 0.71
121 0.8
122 0.83
123 0.83
124 0.8
125 0.81
126 0.85
127 0.86
128 0.88
129 0.85
130 0.82
131 0.79
132 0.78
133 0.67
134 0.59
135 0.48
136 0.41
137 0.38
138 0.32
139 0.26
140 0.19