Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3IG57

Protein Details
Accession A0A2H3IG57    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
81-108AAVRKLVTVKKRNRKCRVQPARHSPSSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 14, cyto 10
Family & Domain DBs
Amino Acid Sequences MTPITLEEVKEFLQLEEDGWNRLDRLVTKILDDHTISPLSGRNADSWYLRNVFPALRDFNANVFRELGEVVDDDQTNEITAAVRKLVTVKKRNRKCRVQPARHSPSSPAKQALGRNTAANTIDVLSIPDETEENDNSSVDENPRDDLVQKKTKAMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.17
4 0.18
5 0.17
6 0.18
7 0.18
8 0.16
9 0.17
10 0.18
11 0.14
12 0.18
13 0.22
14 0.22
15 0.22
16 0.24
17 0.25
18 0.25
19 0.25
20 0.22
21 0.19
22 0.19
23 0.17
24 0.16
25 0.17
26 0.16
27 0.17
28 0.17
29 0.15
30 0.17
31 0.18
32 0.2
33 0.18
34 0.2
35 0.2
36 0.19
37 0.19
38 0.18
39 0.17
40 0.17
41 0.19
42 0.18
43 0.16
44 0.18
45 0.17
46 0.2
47 0.25
48 0.24
49 0.21
50 0.19
51 0.18
52 0.17
53 0.16
54 0.12
55 0.07
56 0.06
57 0.06
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.06
64 0.06
65 0.05
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.09
73 0.14
74 0.21
75 0.3
76 0.4
77 0.5
78 0.6
79 0.7
80 0.76
81 0.82
82 0.84
83 0.86
84 0.88
85 0.87
86 0.88
87 0.88
88 0.88
89 0.8
90 0.71
91 0.65
92 0.64
93 0.59
94 0.52
95 0.44
96 0.37
97 0.39
98 0.42
99 0.42
100 0.37
101 0.33
102 0.31
103 0.29
104 0.3
105 0.26
106 0.22
107 0.17
108 0.13
109 0.12
110 0.1
111 0.1
112 0.09
113 0.08
114 0.08
115 0.08
116 0.07
117 0.08
118 0.11
119 0.12
120 0.14
121 0.14
122 0.14
123 0.14
124 0.15
125 0.16
126 0.16
127 0.18
128 0.17
129 0.18
130 0.19
131 0.2
132 0.21
133 0.26
134 0.33
135 0.38
136 0.39