Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3IAT2

Protein Details
Accession A0A2H3IAT2   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-48AAKSHIPIVKKRTKRFFRHQSDTFKCVPASWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 12, nucl 4.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAAKSHIPIVKKRTKRFFRHQSDTFKCVPASWRKPKGIDNRVRRRFKGTIAMPSIGYGSNKKTRHLMPSGHKAFLVHNTKDVELLLMHNRTYAAEIASAVSSRKRVDILAKAKALGVKVTNAKARVTTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.82
3 0.86
4 0.87
5 0.87
6 0.88
7 0.86
8 0.86
9 0.82
10 0.78
11 0.69
12 0.61
13 0.51
14 0.42
15 0.42
16 0.41
17 0.45
18 0.5
19 0.55
20 0.56
21 0.6
22 0.66
23 0.7
24 0.7
25 0.7
26 0.7
27 0.73
28 0.8
29 0.82
30 0.76
31 0.73
32 0.65
33 0.59
34 0.57
35 0.49
36 0.47
37 0.44
38 0.43
39 0.36
40 0.33
41 0.3
42 0.21
43 0.19
44 0.12
45 0.13
46 0.2
47 0.21
48 0.22
49 0.25
50 0.26
51 0.31
52 0.33
53 0.36
54 0.34
55 0.44
56 0.45
57 0.42
58 0.4
59 0.35
60 0.32
61 0.34
62 0.34
63 0.24
64 0.25
65 0.26
66 0.26
67 0.26
68 0.25
69 0.17
70 0.1
71 0.12
72 0.13
73 0.13
74 0.12
75 0.12
76 0.13
77 0.12
78 0.13
79 0.12
80 0.08
81 0.08
82 0.08
83 0.09
84 0.09
85 0.09
86 0.08
87 0.09
88 0.11
89 0.12
90 0.13
91 0.13
92 0.14
93 0.2
94 0.29
95 0.34
96 0.39
97 0.4
98 0.39
99 0.39
100 0.39
101 0.34
102 0.28
103 0.23
104 0.21
105 0.25
106 0.3
107 0.34
108 0.34
109 0.34
110 0.34