Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3IEA5

Protein Details
Accession A0A2H3IEA5    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-68LHRKIPWRLSSRQKFRQRKRLRAVDNVHydrophilic
108-135IYDRKEKTYRKGIHKLPKWTRVSQRVNPHydrophilic
NLS Segment(s)
PositionSequence
57-60RQRK
Subcellular Location(s) mito 14, nucl 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKVTSPLLGGLLWYFPHTVLAIHSGSVSEETTANKNFFFDLHRKIPWRLSSRQKFRQRKRLRAVDNVVDTVAAALERNGLPQVKAVERWYAEMPREEEMLPKDKYSIYDRKEKTYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.1
5 0.1
6 0.09
7 0.09
8 0.13
9 0.12
10 0.11
11 0.11
12 0.1
13 0.1
14 0.11
15 0.1
16 0.07
17 0.08
18 0.1
19 0.14
20 0.16
21 0.17
22 0.15
23 0.16
24 0.15
25 0.15
26 0.17
27 0.19
28 0.23
29 0.27
30 0.3
31 0.33
32 0.36
33 0.41
34 0.44
35 0.45
36 0.45
37 0.52
38 0.58
39 0.64
40 0.72
41 0.77
42 0.8
43 0.84
44 0.88
45 0.86
46 0.87
47 0.87
48 0.86
49 0.8
50 0.78
51 0.73
52 0.67
53 0.59
54 0.48
55 0.39
56 0.29
57 0.23
58 0.15
59 0.1
60 0.04
61 0.03
62 0.02
63 0.04
64 0.04
65 0.05
66 0.06
67 0.06
68 0.07
69 0.09
70 0.11
71 0.11
72 0.13
73 0.14
74 0.17
75 0.17
76 0.19
77 0.2
78 0.2
79 0.21
80 0.22
81 0.23
82 0.21
83 0.22
84 0.19
85 0.2
86 0.21
87 0.25
88 0.23
89 0.21
90 0.21
91 0.2
92 0.24
93 0.28
94 0.33
95 0.31
96 0.4
97 0.42
98 0.5
99 0.58
100 0.62
101 0.63
102 0.65
103 0.69
104 0.69
105 0.77
106 0.77
107 0.79
108 0.81
109 0.84
110 0.83
111 0.84
112 0.8
113 0.79
114 0.8
115 0.79
116 0.8
117 0.78
118 0.8