Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3IBA5

Protein Details
Accession A0A2H3IBA5   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-48MPGARSFRVSKKKKEAKKAKKIVFETPHydrophilic
NLS Segment(s)
PositionSequence
29-42RVSKKKKEAKKAKK
70-78RRKRAKAKR
Subcellular Location(s) mito 15, nucl 7.5, cyto_nucl 6.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPQNIHNYIVSAGAQINITSTMPGARSFRVSKKKKEAKKAKKIVFETPEGLRAEAARLIEAADREEEEVRRKRAKAKRLSMEAEEMEKKIEKRVEGDEEMVMEDAEQKAGEEGEVVEEKILEVRFEKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.09
4 0.09
5 0.09
6 0.08
7 0.08
8 0.08
9 0.09
10 0.12
11 0.13
12 0.13
13 0.18
14 0.22
15 0.31
16 0.41
17 0.47
18 0.54
19 0.63
20 0.71
21 0.75
22 0.82
23 0.84
24 0.85
25 0.89
26 0.9
27 0.86
28 0.85
29 0.8
30 0.77
31 0.7
32 0.61
33 0.53
34 0.44
35 0.41
36 0.33
37 0.29
38 0.21
39 0.17
40 0.15
41 0.13
42 0.12
43 0.07
44 0.06
45 0.07
46 0.08
47 0.08
48 0.07
49 0.06
50 0.06
51 0.07
52 0.08
53 0.09
54 0.15
55 0.19
56 0.23
57 0.27
58 0.29
59 0.37
60 0.44
61 0.52
62 0.56
63 0.6
64 0.64
65 0.65
66 0.68
67 0.6
68 0.56
69 0.48
70 0.41
71 0.33
72 0.26
73 0.21
74 0.2
75 0.19
76 0.2
77 0.22
78 0.19
79 0.21
80 0.25
81 0.3
82 0.29
83 0.3
84 0.25
85 0.23
86 0.22
87 0.2
88 0.14
89 0.09
90 0.09
91 0.07
92 0.07
93 0.07
94 0.06
95 0.07
96 0.07
97 0.07
98 0.06
99 0.06
100 0.09
101 0.1
102 0.1
103 0.1
104 0.1
105 0.1
106 0.13
107 0.13
108 0.11
109 0.12