Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BTH0

Protein Details
Accession G8BTH0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-31PPPPGGQRILRRRRQVQSSKEKKAKQTHydrophilic
NLS Segment(s)
PositionSequence
15-28RRRRQVQSSKEKKA
Subcellular Location(s) plas 11, mito 10, nucl 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR030671  Sec61-beta/Sbh  
IPR016482  SecG/Sec61-beta/Sbh  
Gene Ontology GO:0005784  C:Sec61 translocon complex  
GO:0006886  P:intracellular protein transport  
KEGG tpf:TPHA_0E01040  -  
Pfam View protein in Pfam  
PF03911  Sec61_beta  
Amino Acid Sequences MVATPPPPGGQRILRRRRQVQSSKEKKAKQTPTSARSAGFGGSSGSILKVFTEEANAFRIDSLIVLFLAFGFVLSVFGLHIVNKMSGRLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.7
3 0.76
4 0.79
5 0.81
6 0.81
7 0.8
8 0.81
9 0.83
10 0.84
11 0.84
12 0.81
13 0.79
14 0.79
15 0.78
16 0.73
17 0.73
18 0.72
19 0.68
20 0.68
21 0.61
22 0.51
23 0.43
24 0.37
25 0.27
26 0.18
27 0.13
28 0.08
29 0.07
30 0.07
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.04
37 0.05
38 0.05
39 0.07
40 0.08
41 0.08
42 0.1
43 0.11
44 0.1
45 0.1
46 0.1
47 0.07
48 0.07
49 0.06
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.06
67 0.07
68 0.09
69 0.11
70 0.12