Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3IYI7

Protein Details
Accession A0A2H3IYI7    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
233-252PNTFQGRKYRRRFWNDTIFDHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 7, cyto 6.5, cyto_nucl 5.5, mito 5, pero 4, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023210  NADP_OxRdtase_dom  
IPR036812  NADP_OxRdtase_dom_sf  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00248  Aldo_ket_red  
CDD cd19075  AKR_AKR7A1-5  
Amino Acid Sequences MAPEQKTKIPIVFGAMTFGRKGVEQARIHDFKDASAMLDLFQSHGGKVVDTARVYGEGSSEEYLGELDWQGRGLVVDTKLYPNVADGTGNMTHSAEDLRKYLDESLRALKTDKIDLWYLHGPDRNTPYEETFRTCNELHKEGKFNRLGLSNYMAWEVAYISDMCIHNGWIRPTVYQGVYNAIHRTVELELFPCLRHYGITFYAFSPLAGSQLTGRYKRDTSDTSIESMSRFDPNTFQGRKYRRRFWNDTIFDALDVIREAAGKHQLTEMECALRWIVHHSQLDSSRGDSVIIGASSLQQLEQNLGDLEKEPLPENVVEALDKAWAITKGIVKNYWH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.24
4 0.22
5 0.21
6 0.16
7 0.14
8 0.17
9 0.18
10 0.26
11 0.27
12 0.32
13 0.41
14 0.43
15 0.44
16 0.46
17 0.41
18 0.32
19 0.34
20 0.29
21 0.22
22 0.2
23 0.2
24 0.14
25 0.15
26 0.15
27 0.11
28 0.14
29 0.13
30 0.11
31 0.15
32 0.15
33 0.14
34 0.16
35 0.18
36 0.19
37 0.19
38 0.2
39 0.16
40 0.17
41 0.18
42 0.16
43 0.13
44 0.1
45 0.12
46 0.12
47 0.11
48 0.1
49 0.09
50 0.09
51 0.08
52 0.08
53 0.06
54 0.06
55 0.06
56 0.07
57 0.06
58 0.06
59 0.07
60 0.07
61 0.11
62 0.11
63 0.13
64 0.14
65 0.16
66 0.16
67 0.16
68 0.15
69 0.12
70 0.13
71 0.11
72 0.1
73 0.09
74 0.13
75 0.13
76 0.14
77 0.13
78 0.11
79 0.11
80 0.11
81 0.13
82 0.1
83 0.11
84 0.11
85 0.12
86 0.13
87 0.14
88 0.18
89 0.18
90 0.19
91 0.2
92 0.25
93 0.25
94 0.25
95 0.25
96 0.23
97 0.23
98 0.24
99 0.23
100 0.19
101 0.2
102 0.2
103 0.24
104 0.24
105 0.24
106 0.23
107 0.25
108 0.23
109 0.25
110 0.3
111 0.27
112 0.26
113 0.26
114 0.27
115 0.28
116 0.29
117 0.28
118 0.25
119 0.23
120 0.26
121 0.25
122 0.27
123 0.26
124 0.3
125 0.3
126 0.31
127 0.37
128 0.35
129 0.42
130 0.38
131 0.34
132 0.32
133 0.31
134 0.29
135 0.24
136 0.25
137 0.18
138 0.17
139 0.17
140 0.14
141 0.11
142 0.1
143 0.08
144 0.05
145 0.05
146 0.05
147 0.04
148 0.08
149 0.08
150 0.08
151 0.08
152 0.09
153 0.1
154 0.12
155 0.13
156 0.13
157 0.13
158 0.13
159 0.14
160 0.16
161 0.15
162 0.14
163 0.13
164 0.14
165 0.14
166 0.16
167 0.15
168 0.13
169 0.12
170 0.11
171 0.12
172 0.08
173 0.08
174 0.07
175 0.07
176 0.08
177 0.09
178 0.09
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.1
185 0.12
186 0.14
187 0.14
188 0.14
189 0.16
190 0.16
191 0.15
192 0.13
193 0.1
194 0.09
195 0.08
196 0.08
197 0.07
198 0.12
199 0.16
200 0.17
201 0.19
202 0.22
203 0.23
204 0.24
205 0.28
206 0.26
207 0.28
208 0.32
209 0.32
210 0.3
211 0.3
212 0.29
213 0.24
214 0.22
215 0.18
216 0.14
217 0.13
218 0.12
219 0.14
220 0.17
221 0.26
222 0.26
223 0.28
224 0.35
225 0.43
226 0.53
227 0.59
228 0.65
229 0.66
230 0.74
231 0.79
232 0.79
233 0.81
234 0.74
235 0.69
236 0.63
237 0.54
238 0.44
239 0.36
240 0.28
241 0.17
242 0.14
243 0.11
244 0.06
245 0.06
246 0.06
247 0.09
248 0.16
249 0.15
250 0.16
251 0.17
252 0.2
253 0.21
254 0.24
255 0.22
256 0.18
257 0.18
258 0.18
259 0.16
260 0.14
261 0.13
262 0.16
263 0.18
264 0.23
265 0.25
266 0.25
267 0.31
268 0.33
269 0.36
270 0.31
271 0.29
272 0.24
273 0.22
274 0.21
275 0.15
276 0.13
277 0.13
278 0.11
279 0.1
280 0.08
281 0.09
282 0.1
283 0.1
284 0.09
285 0.08
286 0.09
287 0.11
288 0.11
289 0.12
290 0.11
291 0.11
292 0.12
293 0.11
294 0.14
295 0.14
296 0.15
297 0.15
298 0.15
299 0.18
300 0.17
301 0.18
302 0.17
303 0.16
304 0.15
305 0.14
306 0.13
307 0.12
308 0.11
309 0.1
310 0.11
311 0.11
312 0.12
313 0.16
314 0.22
315 0.27
316 0.31