Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3IIZ0

Protein Details
Accession A0A2H3IIZ0   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
222-243ANLPAKRKDADRRRAPRRDEYLBasic
NLS Segment(s)
PositionSequence
64-76RKAEEPLRRPEKP
86-199KARPKAPLPTRPTVTKKSTPPAAPAKPPPKGSFADLMAKAKAVQKEAPKVGVLKHQTALPKGKISKTEMKRRMEAAAKGKEAARSGKRPGVSPAPNTGKKMDGKPGGDVGAKKR
226-238AKRKDADRRRAPR
301-319KRAKMERKQKLTALARARR
Subcellular Location(s) mito_nucl 11.333, mito 11, nucl 10.5, cyto_mito 8.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Pfam View protein in Pfam  
PF08243  SPT2  
Amino Acid Sequences MSFLSSVLSSIETGTPTSLPKTTPRPSTSVVSATTAKSEPRKLTPSAPTSNRPTSSNTSAGIKRKAEEPLRRPEKPSSTTNGSDVKARPKAPLPTRPTVTKKSTPPAAPAKPPPKGSFADLMAKAKAVQKEAPKVGVLKHQTALPKGKISKTEMKRRMEAAAKGKEAARSGKRPGVSPAPNTGKKMDGKPGGDVGAKKREPEENAYKGTSRSVQPSSYKGTANLPAKRKDADRRRAPRRDEYLGTDEEDEGDFYDDYDDYYSDASSDMEAGYGDMEKEEFAALRAAQKEDEEDMRLEAEAKRAKMERKQKLTALARARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.14
4 0.17
5 0.17
6 0.18
7 0.24
8 0.32
9 0.38
10 0.45
11 0.47
12 0.5
13 0.52
14 0.55
15 0.53
16 0.48
17 0.42
18 0.37
19 0.36
20 0.31
21 0.3
22 0.26
23 0.27
24 0.29
25 0.34
26 0.34
27 0.39
28 0.43
29 0.43
30 0.49
31 0.53
32 0.54
33 0.56
34 0.57
35 0.57
36 0.6
37 0.64
38 0.59
39 0.52
40 0.51
41 0.49
42 0.49
43 0.46
44 0.39
45 0.38
46 0.42
47 0.46
48 0.47
49 0.41
50 0.37
51 0.38
52 0.45
53 0.48
54 0.52
55 0.52
56 0.56
57 0.63
58 0.64
59 0.65
60 0.64
61 0.63
62 0.58
63 0.57
64 0.53
65 0.51
66 0.5
67 0.5
68 0.47
69 0.39
70 0.4
71 0.38
72 0.39
73 0.38
74 0.37
75 0.36
76 0.37
77 0.46
78 0.48
79 0.54
80 0.53
81 0.55
82 0.58
83 0.62
84 0.63
85 0.61
86 0.6
87 0.58
88 0.56
89 0.55
90 0.58
91 0.52
92 0.52
93 0.54
94 0.51
95 0.5
96 0.54
97 0.55
98 0.53
99 0.55
100 0.51
101 0.46
102 0.44
103 0.41
104 0.35
105 0.3
106 0.31
107 0.29
108 0.29
109 0.24
110 0.23
111 0.21
112 0.22
113 0.21
114 0.17
115 0.19
116 0.22
117 0.28
118 0.29
119 0.29
120 0.26
121 0.25
122 0.25
123 0.27
124 0.26
125 0.21
126 0.21
127 0.22
128 0.23
129 0.26
130 0.29
131 0.24
132 0.26
133 0.26
134 0.28
135 0.29
136 0.32
137 0.38
138 0.41
139 0.5
140 0.53
141 0.54
142 0.54
143 0.52
144 0.51
145 0.46
146 0.43
147 0.4
148 0.37
149 0.34
150 0.33
151 0.32
152 0.3
153 0.27
154 0.28
155 0.25
156 0.24
157 0.27
158 0.29
159 0.29
160 0.29
161 0.31
162 0.33
163 0.32
164 0.3
165 0.35
166 0.38
167 0.4
168 0.4
169 0.38
170 0.34
171 0.34
172 0.34
173 0.33
174 0.31
175 0.3
176 0.29
177 0.29
178 0.27
179 0.26
180 0.25
181 0.23
182 0.27
183 0.26
184 0.26
185 0.27
186 0.29
187 0.3
188 0.36
189 0.39
190 0.34
191 0.37
192 0.38
193 0.37
194 0.33
195 0.32
196 0.28
197 0.22
198 0.22
199 0.22
200 0.25
201 0.26
202 0.29
203 0.33
204 0.33
205 0.31
206 0.28
207 0.29
208 0.32
209 0.37
210 0.4
211 0.4
212 0.42
213 0.44
214 0.45
215 0.48
216 0.51
217 0.54
218 0.58
219 0.63
220 0.68
221 0.77
222 0.83
223 0.83
224 0.82
225 0.79
226 0.75
227 0.68
228 0.64
229 0.58
230 0.51
231 0.46
232 0.37
233 0.3
234 0.24
235 0.21
236 0.15
237 0.1
238 0.11
239 0.09
240 0.08
241 0.09
242 0.08
243 0.08
244 0.09
245 0.09
246 0.07
247 0.08
248 0.08
249 0.07
250 0.07
251 0.07
252 0.06
253 0.07
254 0.06
255 0.06
256 0.06
257 0.06
258 0.06
259 0.06
260 0.06
261 0.06
262 0.06
263 0.06
264 0.06
265 0.07
266 0.06
267 0.07
268 0.09
269 0.09
270 0.15
271 0.17
272 0.18
273 0.18
274 0.19
275 0.21
276 0.22
277 0.24
278 0.21
279 0.2
280 0.19
281 0.19
282 0.18
283 0.18
284 0.16
285 0.21
286 0.24
287 0.24
288 0.29
289 0.34
290 0.41
291 0.48
292 0.58
293 0.6
294 0.64
295 0.7
296 0.68
297 0.74
298 0.74
299 0.74