Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3HXF6

Protein Details
Accession A0A2H3HXF6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
132-153SLTTKFKRTKKFIPTRSHPTAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012312  Hemerythrin-like  
Pfam View protein in Pfam  
PF01814  Hemerythrin  
Amino Acid Sequences MTLISQTLKNDHRELKDAYNKILSATSADEKRRWQNQFTWELARHSIGEELLVYPAFEKRLPDGKQLADKDRTEHQKVKELLYKFQGLKPNDHEFNPTLQALWSDLSQHIKEEEEQDLVKLENALQQYESESLTTKFKRTKKFIPTRSHPTAPDKPPFETVAGLLAAPLDHLSDIFRKFPGESKSELPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.56
4 0.53
5 0.5
6 0.47
7 0.43
8 0.39
9 0.36
10 0.27
11 0.2
12 0.21
13 0.24
14 0.25
15 0.29
16 0.3
17 0.35
18 0.43
19 0.5
20 0.5
21 0.49
22 0.5
23 0.55
24 0.59
25 0.57
26 0.55
27 0.48
28 0.47
29 0.44
30 0.38
31 0.3
32 0.24
33 0.21
34 0.14
35 0.12
36 0.1
37 0.09
38 0.08
39 0.08
40 0.07
41 0.06
42 0.08
43 0.09
44 0.09
45 0.09
46 0.12
47 0.21
48 0.24
49 0.28
50 0.3
51 0.32
52 0.38
53 0.4
54 0.42
55 0.39
56 0.37
57 0.35
58 0.39
59 0.43
60 0.42
61 0.44
62 0.41
63 0.44
64 0.45
65 0.47
66 0.46
67 0.4
68 0.38
69 0.35
70 0.37
71 0.29
72 0.32
73 0.35
74 0.3
75 0.32
76 0.35
77 0.37
78 0.34
79 0.33
80 0.32
81 0.26
82 0.27
83 0.25
84 0.19
85 0.14
86 0.12
87 0.12
88 0.1
89 0.09
90 0.07
91 0.07
92 0.08
93 0.11
94 0.11
95 0.11
96 0.11
97 0.11
98 0.12
99 0.13
100 0.13
101 0.12
102 0.12
103 0.11
104 0.12
105 0.11
106 0.1
107 0.08
108 0.07
109 0.09
110 0.09
111 0.1
112 0.09
113 0.09
114 0.11
115 0.12
116 0.12
117 0.09
118 0.1
119 0.11
120 0.17
121 0.18
122 0.21
123 0.28
124 0.34
125 0.44
126 0.5
127 0.58
128 0.63
129 0.72
130 0.76
131 0.79
132 0.81
133 0.81
134 0.81
135 0.76
136 0.69
137 0.67
138 0.68
139 0.64
140 0.64
141 0.58
142 0.52
143 0.51
144 0.49
145 0.42
146 0.33
147 0.27
148 0.21
149 0.18
150 0.15
151 0.11
152 0.09
153 0.08
154 0.07
155 0.07
156 0.05
157 0.04
158 0.05
159 0.07
160 0.12
161 0.14
162 0.16
163 0.17
164 0.18
165 0.19
166 0.26
167 0.3
168 0.29
169 0.31