Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3IA21

Protein Details
Accession A0A2H3IA21    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-39MGMRKNGKNWRTPKKPFRPTAGLKHydrophilic
88-116RYEKMAEKMHKKRVERRKRREKRNKMLNSBasic
NLS Segment(s)
PositionSequence
19-44RKNGKNWRTPKKPFRPTAGLKSYEKR
54-112MKEREKEMKDEKEAERQRHIQAIKDRRAAKEEKERYEKMAEKMHKKRVERRKRREKRNK
Subcellular Location(s) nucl 22, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSEVAVPVPDSGKTEMGMRKNGKNWRTPKKPFRPTAGLKSYEKRLQDRNNMAAMKEREKEMKDEKEAERQRHIQAIKDRRAAKEEKERYEKMAEKMHKKRVERRKRREKRNKMLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.28
4 0.35
5 0.37
6 0.4
7 0.47
8 0.55
9 0.54
10 0.57
11 0.63
12 0.65
13 0.71
14 0.75
15 0.79
16 0.82
17 0.87
18 0.84
19 0.82
20 0.8
21 0.76
22 0.76
23 0.72
24 0.66
25 0.59
26 0.57
27 0.55
28 0.5
29 0.47
30 0.41
31 0.42
32 0.45
33 0.5
34 0.51
35 0.49
36 0.5
37 0.47
38 0.43
39 0.41
40 0.36
41 0.31
42 0.27
43 0.25
44 0.23
45 0.24
46 0.28
47 0.27
48 0.3
49 0.28
50 0.33
51 0.33
52 0.4
53 0.45
54 0.44
55 0.43
56 0.42
57 0.41
58 0.42
59 0.41
60 0.37
61 0.41
62 0.47
63 0.48
64 0.52
65 0.53
66 0.49
67 0.53
68 0.49
69 0.48
70 0.49
71 0.51
72 0.52
73 0.57
74 0.56
75 0.55
76 0.59
77 0.57
78 0.51
79 0.53
80 0.52
81 0.55
82 0.63
83 0.69
84 0.69
85 0.7
86 0.76
87 0.78
88 0.82
89 0.82
90 0.85
91 0.87
92 0.9
93 0.95
94 0.96
95 0.96
96 0.96