Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BQT1

Protein Details
Accession G8BQT1   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
43-73LKSSSAGKSKKGKKKKLKKQNMKVAKKPLTLHydrophilic
NLS Segment(s)
PositionSequence
48-69AGKSKKGKKKKLKKQNMKVAKK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
Gene Ontology GO:0016020  C:membrane  
GO:0051087  F:protein-folding chaperone binding  
KEGG tpf:TPHA_0C04430  -  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
Amino Acid Sequences MDLFQQLFDTDLKSLINKTQNDNLMATLCITGVTATLLAIFLLKSSSAGKSKKGKKKKLKKQNMKVAKKPLTLEEKIEKVLGTYNTEYRDGINKLLETFDKSEKQVYEKNYFNEMLLKLLIELDGVDLMDISDPERKTALKLRRKEAIKLIQGELNKLDNLSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.26
4 0.27
5 0.32
6 0.38
7 0.41
8 0.42
9 0.41
10 0.35
11 0.29
12 0.26
13 0.22
14 0.15
15 0.11
16 0.08
17 0.08
18 0.06
19 0.05
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.05
32 0.06
33 0.1
34 0.16
35 0.18
36 0.24
37 0.34
38 0.44
39 0.54
40 0.63
41 0.7
42 0.75
43 0.85
44 0.89
45 0.91
46 0.93
47 0.94
48 0.94
49 0.94
50 0.94
51 0.91
52 0.87
53 0.86
54 0.81
55 0.73
56 0.63
57 0.58
58 0.54
59 0.46
60 0.43
61 0.36
62 0.31
63 0.28
64 0.27
65 0.21
66 0.14
67 0.16
68 0.13
69 0.13
70 0.13
71 0.14
72 0.16
73 0.16
74 0.16
75 0.14
76 0.18
77 0.16
78 0.16
79 0.15
80 0.14
81 0.13
82 0.15
83 0.14
84 0.12
85 0.14
86 0.17
87 0.18
88 0.18
89 0.22
90 0.21
91 0.25
92 0.27
93 0.29
94 0.32
95 0.33
96 0.35
97 0.35
98 0.35
99 0.31
100 0.31
101 0.26
102 0.21
103 0.17
104 0.15
105 0.11
106 0.11
107 0.1
108 0.06
109 0.05
110 0.04
111 0.04
112 0.04
113 0.04
114 0.03
115 0.04
116 0.04
117 0.04
118 0.05
119 0.11
120 0.11
121 0.12
122 0.14
123 0.14
124 0.18
125 0.27
126 0.36
127 0.4
128 0.48
129 0.53
130 0.6
131 0.64
132 0.65
133 0.66
134 0.66
135 0.64
136 0.61
137 0.58
138 0.53
139 0.5
140 0.47
141 0.4
142 0.33
143 0.26