Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3IBJ5

Protein Details
Accession A0A2H3IBJ5    Localization Confidence High Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
170-196NGSAEKERRHHRHRHRHRDDEDRRSRHBasic
233-284RRSPSPSRHTSRRSRSPRREHREHRERSYSPQPRRRDRSPRRDRDRDYERNDBasic
NLS Segment(s)
PositionSequence
172-201SAEKERRHHRHRHRHRDDEDRRSRHRSRRH
209-278RKHRRRRDSVSGSRSRSPVRQSRSRRSPSPSRHTSRRSRSPRREHREHRERSYSPQPRRRDRSPRRDRDR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019339  CIR_N_dom  
IPR022209  CWC25  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF10197  Cir_N  
PF12542  CWC25  
Amino Acid Sequences MGGDLNLKKSWNPVLQKNQEKTWLAEKKALEERKRIDQMMRERQEERQMLEIQQLQEAAGGKKRLNRVDWMYSGPSSGQLGTTEEMEGYLLGKRRIDGLIKGSENQKLEKAAAEDSFMALQNANTARDTAAKIREDPMLAIKKQEQAAYEAMMNDPVRRRQLMQAAGKENGSAEKERRHHRHRHRHRDDEDRRSRHRSRRHDYDDDDDRKHRRRRDSVSGSRSRSPVRQSRSRRSPSPSRHTSRRSRSPRREHREHRERSYSPQPRRRDRSPRRDRDRDYERNDRRQTWHHNPRPAPPQREAQASSKSAEEERAAKLAAMQQNANELDQVRANRLAAADAREKAEREADEAARARTSKDGGKGAFLSNINKRAGELDLSERLQRGRRNVEKEQEAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.66
3 0.75
4 0.75
5 0.72
6 0.72
7 0.67
8 0.61
9 0.61
10 0.59
11 0.52
12 0.53
13 0.49
14 0.48
15 0.55
16 0.6
17 0.56
18 0.56
19 0.58
20 0.62
21 0.67
22 0.62
23 0.58
24 0.58
25 0.62
26 0.65
27 0.65
28 0.59
29 0.56
30 0.58
31 0.62
32 0.57
33 0.49
34 0.44
35 0.41
36 0.38
37 0.41
38 0.41
39 0.32
40 0.3
41 0.27
42 0.21
43 0.2
44 0.22
45 0.19
46 0.19
47 0.21
48 0.22
49 0.27
50 0.35
51 0.38
52 0.38
53 0.44
54 0.45
55 0.49
56 0.5
57 0.48
58 0.45
59 0.39
60 0.37
61 0.3
62 0.24
63 0.18
64 0.16
65 0.13
66 0.1
67 0.12
68 0.12
69 0.12
70 0.11
71 0.1
72 0.1
73 0.09
74 0.08
75 0.06
76 0.09
77 0.11
78 0.12
79 0.13
80 0.13
81 0.16
82 0.18
83 0.2
84 0.2
85 0.22
86 0.28
87 0.28
88 0.31
89 0.31
90 0.33
91 0.32
92 0.31
93 0.27
94 0.22
95 0.22
96 0.21
97 0.2
98 0.18
99 0.17
100 0.17
101 0.15
102 0.14
103 0.14
104 0.12
105 0.11
106 0.08
107 0.08
108 0.11
109 0.12
110 0.12
111 0.11
112 0.12
113 0.12
114 0.14
115 0.16
116 0.17
117 0.21
118 0.21
119 0.22
120 0.24
121 0.25
122 0.23
123 0.22
124 0.25
125 0.25
126 0.24
127 0.25
128 0.25
129 0.28
130 0.29
131 0.3
132 0.23
133 0.2
134 0.21
135 0.2
136 0.18
137 0.15
138 0.13
139 0.14
140 0.14
141 0.13
142 0.15
143 0.17
144 0.18
145 0.19
146 0.21
147 0.23
148 0.29
149 0.34
150 0.38
151 0.4
152 0.41
153 0.4
154 0.38
155 0.34
156 0.27
157 0.21
158 0.17
159 0.14
160 0.13
161 0.19
162 0.25
163 0.34
164 0.43
165 0.48
166 0.57
167 0.66
168 0.75
169 0.8
170 0.85
171 0.86
172 0.87
173 0.85
174 0.86
175 0.83
176 0.83
177 0.81
178 0.77
179 0.72
180 0.71
181 0.73
182 0.7
183 0.71
184 0.71
185 0.69
186 0.73
187 0.76
188 0.73
189 0.69
190 0.67
191 0.67
192 0.61
193 0.55
194 0.49
195 0.47
196 0.5
197 0.54
198 0.53
199 0.53
200 0.57
201 0.62
202 0.69
203 0.73
204 0.74
205 0.77
206 0.78
207 0.73
208 0.67
209 0.62
210 0.54
211 0.47
212 0.45
213 0.43
214 0.42
215 0.48
216 0.53
217 0.61
218 0.69
219 0.72
220 0.7
221 0.7
222 0.73
223 0.73
224 0.74
225 0.73
226 0.7
227 0.73
228 0.75
229 0.78
230 0.77
231 0.78
232 0.79
233 0.81
234 0.85
235 0.87
236 0.9
237 0.9
238 0.91
239 0.9
240 0.9
241 0.9
242 0.87
243 0.83
244 0.81
245 0.73
246 0.69
247 0.71
248 0.69
249 0.68
250 0.69
251 0.71
252 0.72
253 0.78
254 0.81
255 0.81
256 0.83
257 0.84
258 0.87
259 0.89
260 0.89
261 0.91
262 0.87
263 0.86
264 0.85
265 0.83
266 0.79
267 0.8
268 0.78
269 0.78
270 0.78
271 0.72
272 0.67
273 0.66
274 0.69
275 0.69
276 0.71
277 0.69
278 0.73
279 0.71
280 0.74
281 0.76
282 0.75
283 0.7
284 0.62
285 0.62
286 0.56
287 0.59
288 0.55
289 0.5
290 0.48
291 0.44
292 0.41
293 0.35
294 0.33
295 0.27
296 0.26
297 0.23
298 0.19
299 0.19
300 0.2
301 0.19
302 0.17
303 0.18
304 0.22
305 0.24
306 0.23
307 0.22
308 0.2
309 0.26
310 0.27
311 0.25
312 0.2
313 0.16
314 0.16
315 0.19
316 0.2
317 0.18
318 0.19
319 0.19
320 0.19
321 0.18
322 0.19
323 0.18
324 0.21
325 0.23
326 0.23
327 0.26
328 0.26
329 0.27
330 0.26
331 0.29
332 0.25
333 0.23
334 0.27
335 0.25
336 0.3
337 0.32
338 0.31
339 0.3
340 0.3
341 0.28
342 0.26
343 0.28
344 0.27
345 0.3
346 0.35
347 0.33
348 0.37
349 0.38
350 0.35
351 0.38
352 0.35
353 0.35
354 0.36
355 0.41
356 0.38
357 0.36
358 0.35
359 0.31
360 0.31
361 0.27
362 0.23
363 0.23
364 0.28
365 0.29
366 0.31
367 0.31
368 0.33
369 0.37
370 0.39
371 0.42
372 0.47
373 0.54
374 0.6
375 0.67
376 0.73