Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BXX4

Protein Details
Accession G8BXX4   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
95-115VEELAVKTKIQKKRQSRLAESHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.333, nucl 12, cyto 11.5, mito_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR020491  BLI1  
KEGG tpf:TPHA_0I02490  -  
Pfam View protein in Pfam  
PF17324  BLI1  
Amino Acid Sequences MKGEDRVVYQSIEGLVDKTQEFIDTELAKAISFFSSKSEDNKKWLNEISSTYKLENEGTMKDFEELKKAHIKKVDELEQKVVYFEDLYKEINELVEELAVKTKIQKKRQSRLAES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.12
4 0.12
5 0.11
6 0.11
7 0.11
8 0.11
9 0.11
10 0.15
11 0.14
12 0.14
13 0.14
14 0.14
15 0.13
16 0.12
17 0.12
18 0.09
19 0.08
20 0.08
21 0.09
22 0.13
23 0.14
24 0.2
25 0.28
26 0.28
27 0.33
28 0.39
29 0.37
30 0.37
31 0.38
32 0.33
33 0.27
34 0.29
35 0.31
36 0.29
37 0.29
38 0.26
39 0.24
40 0.23
41 0.22
42 0.19
43 0.13
44 0.11
45 0.11
46 0.11
47 0.11
48 0.11
49 0.13
50 0.12
51 0.15
52 0.15
53 0.16
54 0.24
55 0.25
56 0.27
57 0.31
58 0.33
59 0.33
60 0.39
61 0.46
62 0.43
63 0.44
64 0.45
65 0.42
66 0.39
67 0.35
68 0.28
69 0.19
70 0.14
71 0.13
72 0.11
73 0.11
74 0.12
75 0.12
76 0.12
77 0.12
78 0.12
79 0.11
80 0.09
81 0.08
82 0.08
83 0.08
84 0.08
85 0.11
86 0.11
87 0.11
88 0.18
89 0.26
90 0.35
91 0.44
92 0.53
93 0.61
94 0.71
95 0.8