Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UL07

Protein Details
Accession A0A286UL07    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
59-81HRGAWCFRKRGSKQRGRKPLSEABasic
NLS Segment(s)
PositionSequence
67-76KRGSKQRGRK
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MVVSDRRVLGLILANEVQRRTRGSAGNLYQGKTLEISIKRGREIIMTMPNLNLISLCSHRGAWCFRKRGSKQRGRKPLSEADDKIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.2
5 0.17
6 0.19
7 0.2
8 0.23
9 0.26
10 0.28
11 0.35
12 0.36
13 0.42
14 0.41
15 0.38
16 0.35
17 0.31
18 0.28
19 0.2
20 0.18
21 0.16
22 0.15
23 0.2
24 0.22
25 0.23
26 0.23
27 0.23
28 0.23
29 0.18
30 0.18
31 0.16
32 0.17
33 0.17
34 0.17
35 0.16
36 0.17
37 0.16
38 0.14
39 0.11
40 0.06
41 0.07
42 0.08
43 0.1
44 0.1
45 0.11
46 0.12
47 0.15
48 0.21
49 0.28
50 0.35
51 0.4
52 0.44
53 0.54
54 0.6
55 0.68
56 0.72
57 0.74
58 0.76
59 0.82
60 0.88
61 0.84
62 0.82
63 0.78
64 0.77
65 0.73
66 0.72