Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286UBR8

Protein Details
Accession A0A286UBR8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
36-61RKVRNERGEKRTKKKIWNRYNKGYVGBasic
NLS Segment(s)
PositionSequence
36-51RKVRNERGEKRTKKKI
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 8
Family & Domain DBs
Amino Acid Sequences MDWTVCSSRPNEWKEVHQSAGGIVVIIHTKVDGLSRKVRNERGEKRTKKKIWNRYNKGYVGINLDYKTRYSHNNQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.48
4 0.4
5 0.36
6 0.29
7 0.28
8 0.21
9 0.12
10 0.08
11 0.07
12 0.07
13 0.06
14 0.06
15 0.04
16 0.04
17 0.04
18 0.08
19 0.1
20 0.13
21 0.21
22 0.25
23 0.3
24 0.35
25 0.4
26 0.43
27 0.5
28 0.56
29 0.57
30 0.64
31 0.69
32 0.72
33 0.78
34 0.78
35 0.79
36 0.8
37 0.82
38 0.83
39 0.85
40 0.86
41 0.85
42 0.85
43 0.76
44 0.7
45 0.62
46 0.53
47 0.47
48 0.41
49 0.34
50 0.28
51 0.28
52 0.25
53 0.23
54 0.25
55 0.22
56 0.26