Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BMQ1

Protein Details
Accession G8BMQ1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
56-79VSTIQEKKEKRKKVEEKWKQLEAAHydrophilic
NLS Segment(s)
PositionSequence
62-68KKEKRKK
Subcellular Location(s) cyto_nucl 13.333, nucl 13, cyto 12.5, mito_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
KEGG tpf:TPHA_0A00940  -  
Pfam View protein in Pfam  
PF08583  Cmc1  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MHPQLEQKKFHSCLDFIEALDKCHQKGFYKRVFGVCNNEKDALTECLKEAKRQAVVSTIQEKKEKRKKVEEKWKQLEAAEFGEDMILKKIMEKHNISESDLIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.3
4 0.33
5 0.29
6 0.26
7 0.32
8 0.3
9 0.24
10 0.26
11 0.29
12 0.27
13 0.36
14 0.42
15 0.44
16 0.49
17 0.5
18 0.52
19 0.53
20 0.5
21 0.51
22 0.48
23 0.44
24 0.41
25 0.39
26 0.34
27 0.31
28 0.31
29 0.26
30 0.21
31 0.17
32 0.15
33 0.21
34 0.21
35 0.21
36 0.21
37 0.21
38 0.22
39 0.22
40 0.22
41 0.18
42 0.2
43 0.21
44 0.27
45 0.26
46 0.27
47 0.31
48 0.33
49 0.4
50 0.48
51 0.53
52 0.52
53 0.61
54 0.68
55 0.74
56 0.84
57 0.84
58 0.86
59 0.84
60 0.81
61 0.71
62 0.62
63 0.54
64 0.45
65 0.37
66 0.27
67 0.19
68 0.16
69 0.15
70 0.14
71 0.12
72 0.11
73 0.09
74 0.08
75 0.11
76 0.19
77 0.24
78 0.32
79 0.34
80 0.37
81 0.45
82 0.47
83 0.47