Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BXS8

Protein Details
Accession G8BXS8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-33SNALKQKLGNEKFKKRNEHHRKLGKKKIELSBasic
NLS Segment(s)
PositionSequence
11-36GNEKFKKRNEHHRKLGKKKIELSKKK
Subcellular Location(s) plas 10, nucl 7.5, cyto_nucl 5.333, E.R. 3, cyto_mito 2.333, cyto 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
KEGG tpf:TPHA_0I02020  -  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MASNALKQKLGNEKFKKRNEHHRKLGKKKIELSKKKDQPPISKVWIYILAFLIVGGGILEIISLLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.77
3 0.81
4 0.77
5 0.82
6 0.83
7 0.83
8 0.83
9 0.84
10 0.87
11 0.87
12 0.89
13 0.86
14 0.8
15 0.78
16 0.77
17 0.78
18 0.76
19 0.74
20 0.75
21 0.75
22 0.76
23 0.75
24 0.72
25 0.69
26 0.65
27 0.64
28 0.6
29 0.53
30 0.46
31 0.41
32 0.4
33 0.32
34 0.29
35 0.23
36 0.17
37 0.15
38 0.15
39 0.12
40 0.06
41 0.06
42 0.04
43 0.03
44 0.02
45 0.02
46 0.02