Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BUB7

Protein Details
Accession G8BUB7    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-41KVSLNKKRIRSIKIKTHKNNVQLKKQRSHydrophilic
NLS Segment(s)
PositionSequence
20-26KRIRSIK
Subcellular Location(s) mito 16.5, mito_nucl 11.999, cyto_nucl 6.333, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006856  MATalpha_HMGbox  
Gene Ontology GO:0005634  C:nucleus  
GO:0008301  F:DNA binding, bending  
GO:0045895  P:positive regulation of mating-type specific transcription, DNA-templated  
KEGG tpf:TPHA_0E03620  -  
tpf:TPHA_0E04080  -  
Pfam View protein in Pfam  
PF04769  MATalpha_HMGbox  
PROSITE View protein in PROSITE  
PS51325  ALPHA_BOX  
Amino Acid Sequences MSSVSTWSKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPPTCLLRSIDAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDDINDDIAYINYSSEEELLFKKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCGFVEWVGQTYEREWCTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.62
4 0.69
5 0.72
6 0.7
7 0.74
8 0.77
9 0.75
10 0.74
11 0.74
12 0.76
13 0.78
14 0.84
15 0.83
16 0.85
17 0.83
18 0.83
19 0.83
20 0.81
21 0.81
22 0.8
23 0.8
24 0.77
25 0.8
26 0.79
27 0.74
28 0.7
29 0.65
30 0.63
31 0.61
32 0.62
33 0.58
34 0.52
35 0.47
36 0.44
37 0.4
38 0.33
39 0.33
40 0.31
41 0.3
42 0.32
43 0.38
44 0.39
45 0.4
46 0.41
47 0.36
48 0.33
49 0.3
50 0.27
51 0.27
52 0.25
53 0.25
54 0.23
55 0.23
56 0.23
57 0.22
58 0.2
59 0.19
60 0.19
61 0.19
62 0.21
63 0.22
64 0.23
65 0.23
66 0.22
67 0.23
68 0.23
69 0.2
70 0.18
71 0.16
72 0.12
73 0.12
74 0.11
75 0.06
76 0.05
77 0.06
78 0.07
79 0.06
80 0.07
81 0.06
82 0.07
83 0.07
84 0.07
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.04
97 0.04
98 0.04
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.06
105 0.09
106 0.09
107 0.09
108 0.12
109 0.13
110 0.16
111 0.17
112 0.18
113 0.16
114 0.18
115 0.22
116 0.2
117 0.19
118 0.23
119 0.22
120 0.22
121 0.21
122 0.2
123 0.17
124 0.17
125 0.21
126 0.15
127 0.16
128 0.13
129 0.13
130 0.12
131 0.12
132 0.13
133 0.09
134 0.08
135 0.07
136 0.07
137 0.07
138 0.08
139 0.09
140 0.07
141 0.07
142 0.07
143 0.12
144 0.14
145 0.18
146 0.19
147 0.19
148 0.22
149 0.23
150 0.24
151 0.21
152 0.22
153 0.23
154 0.24
155 0.23
156 0.23
157 0.24
158 0.26
159 0.31
160 0.28
161 0.31
162 0.29
163 0.34
164 0.34
165 0.34
166 0.35
167 0.3
168 0.4
169 0.35
170 0.37
171 0.33
172 0.31
173 0.3
174 0.28
175 0.32