Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AEH6

Protein Details
Accession G3AEH6   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
175-200RTLSRAERKKLVKKNELQHKRNLKNQHydrophilic
NLS Segment(s)
PositionSequence
101-126KAIPKPKPPTKWEQFAARKGIKAKAK
182-188RKKLVKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, cyto 5, cyto_pero 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG spaa:SPAPADRAFT_57806  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSNETEYKPVTVDKPIPNTYDLGNLATFDPNPLDNSKLTSDSDREEYLTSVTRDNVQLLINQILSLPVKTTTDTHGSSTGQNSTMTLIQLPEPSTQLPREKAIPKPKPPTKWEQFAARKGIKAKAKDGKMVYDEATGEWVPKWGYKGKNKELDDQWLVEVDDKVKDTPDELIDPRTLSRAERKKLVKKNELQHKRNLKNQGAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.45
4 0.43
5 0.42
6 0.36
7 0.34
8 0.28
9 0.23
10 0.19
11 0.18
12 0.18
13 0.18
14 0.17
15 0.13
16 0.13
17 0.12
18 0.14
19 0.15
20 0.16
21 0.15
22 0.19
23 0.2
24 0.21
25 0.21
26 0.22
27 0.23
28 0.24
29 0.27
30 0.24
31 0.23
32 0.21
33 0.2
34 0.19
35 0.2
36 0.18
37 0.16
38 0.16
39 0.17
40 0.17
41 0.17
42 0.17
43 0.13
44 0.14
45 0.14
46 0.15
47 0.13
48 0.12
49 0.11
50 0.11
51 0.11
52 0.09
53 0.08
54 0.07
55 0.08
56 0.09
57 0.1
58 0.12
59 0.16
60 0.17
61 0.18
62 0.19
63 0.19
64 0.2
65 0.2
66 0.19
67 0.15
68 0.14
69 0.13
70 0.12
71 0.12
72 0.1
73 0.09
74 0.08
75 0.08
76 0.09
77 0.1
78 0.1
79 0.1
80 0.1
81 0.12
82 0.14
83 0.16
84 0.16
85 0.16
86 0.21
87 0.23
88 0.3
89 0.38
90 0.44
91 0.48
92 0.56
93 0.61
94 0.63
95 0.64
96 0.67
97 0.62
98 0.61
99 0.56
100 0.56
101 0.57
102 0.55
103 0.58
104 0.49
105 0.46
106 0.42
107 0.46
108 0.41
109 0.37
110 0.41
111 0.41
112 0.41
113 0.44
114 0.43
115 0.39
116 0.36
117 0.35
118 0.28
119 0.22
120 0.2
121 0.14
122 0.16
123 0.12
124 0.11
125 0.09
126 0.1
127 0.09
128 0.1
129 0.13
130 0.17
131 0.25
132 0.33
133 0.43
134 0.5
135 0.59
136 0.6
137 0.66
138 0.62
139 0.62
140 0.55
141 0.47
142 0.39
143 0.31
144 0.29
145 0.22
146 0.2
147 0.14
148 0.14
149 0.14
150 0.14
151 0.14
152 0.13
153 0.13
154 0.15
155 0.16
156 0.18
157 0.18
158 0.21
159 0.21
160 0.22
161 0.22
162 0.21
163 0.2
164 0.19
165 0.28
166 0.34
167 0.38
168 0.46
169 0.55
170 0.63
171 0.71
172 0.79
173 0.78
174 0.78
175 0.83
176 0.85
177 0.87
178 0.81
179 0.82
180 0.83
181 0.81
182 0.8
183 0.8