Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BTI5

Protein Details
Accession G8BTI5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
32-58EKNIERKKSVKEAKKQRKLARREQRKLBasic
NLS Segment(s)
PositionSequence
18-60KRHAEKMRLKEQRRSEQEKNIERKKSVKEAKKQRKLARREQRK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
KEGG tpf:TPHA_0E01185  -  
Amino Acid Sequences XXXEYVRKTSAEIKLLEKRHAEKMRLKEQRRSEQEKNIERKKSVKEAKKQRKLARREQRKLDEQNGETNMHQDSESDNGSDSEDDENNYQDVPEDIDSDLFSEVEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.45
3 0.5
4 0.54
5 0.53
6 0.53
7 0.59
8 0.64
9 0.69
10 0.7
11 0.68
12 0.71
13 0.76
14 0.77
15 0.77
16 0.72
17 0.71
18 0.76
19 0.77
20 0.77
21 0.74
22 0.69
23 0.63
24 0.63
25 0.59
26 0.59
27 0.59
28 0.58
29 0.6
30 0.67
31 0.76
32 0.8
33 0.84
34 0.82
35 0.82
36 0.8
37 0.81
38 0.8
39 0.8
40 0.78
41 0.78
42 0.76
43 0.75
44 0.73
45 0.69
46 0.65
47 0.55
48 0.53
49 0.47
50 0.41
51 0.33
52 0.29
53 0.23
54 0.17
55 0.16
56 0.11
57 0.09
58 0.11
59 0.11
60 0.1
61 0.1
62 0.1
63 0.11
64 0.11
65 0.11
66 0.11
67 0.11
68 0.12
69 0.13
70 0.14
71 0.13
72 0.13
73 0.12
74 0.09
75 0.09
76 0.11
77 0.11
78 0.11
79 0.11
80 0.12
81 0.12
82 0.12
83 0.13