Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286UCM3

Protein Details
Accession A0A286UCM3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
68-88DHPQKEVKKLHKKAKEAEKGVBasic
NLS Segment(s)
PositionSequence
58-93SGKKGKGGEVDHPQKEVKKLHKKAKEAEKGVKKTVR
Subcellular Location(s) nucl 12, cyto_nucl 11.5, cyto 9, mito 6
Family & Domain DBs
Amino Acid Sequences MHLSPPKKTDKTPEGEEEEEEVSEWKEGNDLVVERRRCGPGEDVDVEVLHGAACTHKSGKKGKGGEVDHPQKEVKKLHKKAKEAEKGVKKTVRDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.55
3 0.52
4 0.45
5 0.37
6 0.3
7 0.24
8 0.18
9 0.12
10 0.11
11 0.1
12 0.07
13 0.07
14 0.07
15 0.07
16 0.08
17 0.08
18 0.12
19 0.19
20 0.2
21 0.21
22 0.24
23 0.25
24 0.24
25 0.25
26 0.24
27 0.2
28 0.25
29 0.24
30 0.22
31 0.21
32 0.2
33 0.17
34 0.13
35 0.1
36 0.05
37 0.03
38 0.03
39 0.03
40 0.04
41 0.05
42 0.08
43 0.11
44 0.16
45 0.22
46 0.28
47 0.35
48 0.37
49 0.41
50 0.47
51 0.48
52 0.5
53 0.53
54 0.56
55 0.49
56 0.49
57 0.46
58 0.4
59 0.43
60 0.43
61 0.44
62 0.47
63 0.56
64 0.64
65 0.7
66 0.74
67 0.78
68 0.82
69 0.82
70 0.78
71 0.79
72 0.79
73 0.76
74 0.78
75 0.74