Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BN00

Protein Details
Accession G8BN00   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-89GMTTHCRRKGCSRKIKSRNGKVVLCHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, cyto 5, mito 3, cyto_nucl 3
Family & Domain DBs
KEGG tpf:TPHA_0A01950  -  
Amino Acid Sequences MNTLASLFCSNSVLCATPSNPYVTFKQSLKNVITYFNGKVLPRPGSVYGIYFYKGLAGHTGRERGMTTHCRRKGCSRKIKSRNGKVVLCAHVSGPHRLRTQLLAQVLGQAVARCCTHASVASPSFLNFHQILTNPAAGGEEKHICTDNSPCSSCYHFPYIVTLPESLSPLPRAVLTGSFSVSFLFFSQNCNLHTAMGSYCLRGFDWKSLYYPKTAYPVQHRIYLFIDNASLSYITDVILNIVLVNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.16
4 0.18
5 0.2
6 0.23
7 0.23
8 0.25
9 0.27
10 0.29
11 0.34
12 0.32
13 0.37
14 0.37
15 0.43
16 0.42
17 0.44
18 0.39
19 0.38
20 0.39
21 0.36
22 0.33
23 0.3
24 0.31
25 0.25
26 0.29
27 0.31
28 0.3
29 0.28
30 0.3
31 0.28
32 0.28
33 0.28
34 0.26
35 0.22
36 0.2
37 0.19
38 0.16
39 0.14
40 0.13
41 0.12
42 0.11
43 0.15
44 0.14
45 0.17
46 0.21
47 0.24
48 0.21
49 0.22
50 0.22
51 0.19
52 0.24
53 0.31
54 0.36
55 0.43
56 0.49
57 0.51
58 0.53
59 0.63
60 0.67
61 0.68
62 0.71
63 0.71
64 0.77
65 0.83
66 0.91
67 0.91
68 0.9
69 0.89
70 0.84
71 0.75
72 0.69
73 0.64
74 0.56
75 0.47
76 0.37
77 0.27
78 0.26
79 0.27
80 0.28
81 0.25
82 0.28
83 0.27
84 0.28
85 0.28
86 0.26
87 0.27
88 0.25
89 0.23
90 0.18
91 0.17
92 0.18
93 0.17
94 0.14
95 0.12
96 0.08
97 0.07
98 0.08
99 0.08
100 0.07
101 0.07
102 0.07
103 0.07
104 0.08
105 0.09
106 0.12
107 0.13
108 0.13
109 0.13
110 0.13
111 0.14
112 0.13
113 0.14
114 0.1
115 0.1
116 0.1
117 0.11
118 0.13
119 0.13
120 0.13
121 0.1
122 0.09
123 0.09
124 0.08
125 0.08
126 0.09
127 0.09
128 0.1
129 0.11
130 0.12
131 0.11
132 0.12
133 0.16
134 0.18
135 0.2
136 0.21
137 0.21
138 0.22
139 0.26
140 0.27
141 0.27
142 0.26
143 0.23
144 0.22
145 0.25
146 0.25
147 0.23
148 0.22
149 0.19
150 0.15
151 0.15
152 0.17
153 0.13
154 0.13
155 0.12
156 0.11
157 0.11
158 0.1
159 0.1
160 0.09
161 0.11
162 0.11
163 0.11
164 0.12
165 0.11
166 0.12
167 0.11
168 0.1
169 0.09
170 0.08
171 0.11
172 0.1
173 0.13
174 0.17
175 0.2
176 0.21
177 0.23
178 0.22
179 0.2
180 0.2
181 0.18
182 0.14
183 0.16
184 0.16
185 0.15
186 0.15
187 0.15
188 0.15
189 0.18
190 0.2
191 0.2
192 0.24
193 0.24
194 0.27
195 0.33
196 0.35
197 0.34
198 0.34
199 0.3
200 0.32
201 0.34
202 0.36
203 0.38
204 0.46
205 0.46
206 0.51
207 0.48
208 0.45
209 0.45
210 0.43
211 0.34
212 0.26
213 0.24
214 0.17
215 0.17
216 0.15
217 0.13
218 0.09
219 0.09
220 0.09
221 0.08
222 0.08
223 0.08
224 0.08
225 0.08
226 0.08