Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286URB6

Protein Details
Accession A0A286URB6   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
43-64AAQSGKKIRSRLKPKAARLEVHHydrophilic
NLS Segment(s)
PositionSequence
48-57KKIRSRLKPK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006886  RNA_pol_III_Rpc5  
Gene Ontology GO:0005634  C:nucleus  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF04801  RPC5  
Amino Acid Sequences MSQPEDDPIISVLPIHLSTSLAPNLHLHQFPLLTRPLQVPPSAAQSGKKIRSRLKPKAARLEVHVPVDTRQEVWNKERAQELGQARIIDDAEKDPISRENKNPNMDPRLTEVRMRSEQIPSKGAYMLGIVRDGHLHLHPISQTHQFRPTLTYMDVFHRKNRRRANGDDDSDSDDGPPPDPDDPNPPAQVKKEPKAAGEAKEVTVSLRKTDDKGMGAQSSSSGMSAVRREMMQAIREEEDEPWQELKYCDGESEESSEAFNSVFSRSEQRLSCRSDLTTLLKSIPGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.11
6 0.15
7 0.18
8 0.16
9 0.17
10 0.18
11 0.21
12 0.25
13 0.25
14 0.21
15 0.21
16 0.22
17 0.22
18 0.24
19 0.24
20 0.19
21 0.21
22 0.23
23 0.25
24 0.26
25 0.26
26 0.24
27 0.23
28 0.28
29 0.29
30 0.27
31 0.25
32 0.3
33 0.39
34 0.44
35 0.47
36 0.48
37 0.54
38 0.63
39 0.71
40 0.74
41 0.76
42 0.77
43 0.81
44 0.85
45 0.82
46 0.74
47 0.7
48 0.67
49 0.6
50 0.54
51 0.47
52 0.37
53 0.32
54 0.34
55 0.28
56 0.21
57 0.21
58 0.23
59 0.26
60 0.28
61 0.35
62 0.32
63 0.34
64 0.35
65 0.33
66 0.3
67 0.33
68 0.31
69 0.29
70 0.3
71 0.28
72 0.25
73 0.24
74 0.22
75 0.15
76 0.14
77 0.1
78 0.11
79 0.11
80 0.11
81 0.11
82 0.17
83 0.2
84 0.23
85 0.28
86 0.36
87 0.42
88 0.46
89 0.49
90 0.5
91 0.52
92 0.49
93 0.44
94 0.4
95 0.4
96 0.37
97 0.36
98 0.31
99 0.31
100 0.32
101 0.33
102 0.29
103 0.28
104 0.32
105 0.31
106 0.32
107 0.26
108 0.25
109 0.23
110 0.22
111 0.16
112 0.12
113 0.1
114 0.08
115 0.08
116 0.07
117 0.07
118 0.07
119 0.07
120 0.08
121 0.07
122 0.08
123 0.07
124 0.09
125 0.09
126 0.1
127 0.12
128 0.18
129 0.2
130 0.2
131 0.25
132 0.24
133 0.24
134 0.26
135 0.25
136 0.2
137 0.18
138 0.18
139 0.15
140 0.2
141 0.26
142 0.24
143 0.29
144 0.37
145 0.42
146 0.5
147 0.57
148 0.61
149 0.61
150 0.65
151 0.67
152 0.66
153 0.63
154 0.56
155 0.49
156 0.44
157 0.38
158 0.33
159 0.24
160 0.18
161 0.15
162 0.14
163 0.13
164 0.1
165 0.12
166 0.12
167 0.13
168 0.18
169 0.2
170 0.22
171 0.25
172 0.25
173 0.25
174 0.27
175 0.35
176 0.36
177 0.38
178 0.43
179 0.41
180 0.41
181 0.46
182 0.48
183 0.41
184 0.4
185 0.37
186 0.29
187 0.29
188 0.28
189 0.21
190 0.22
191 0.19
192 0.15
193 0.17
194 0.18
195 0.2
196 0.24
197 0.26
198 0.23
199 0.26
200 0.27
201 0.24
202 0.23
203 0.21
204 0.17
205 0.15
206 0.14
207 0.11
208 0.08
209 0.07
210 0.1
211 0.11
212 0.12
213 0.12
214 0.12
215 0.13
216 0.17
217 0.2
218 0.2
219 0.21
220 0.23
221 0.23
222 0.24
223 0.24
224 0.21
225 0.23
226 0.21
227 0.22
228 0.2
229 0.19
230 0.19
231 0.19
232 0.21
233 0.19
234 0.17
235 0.15
236 0.16
237 0.19
238 0.18
239 0.22
240 0.21
241 0.18
242 0.18
243 0.17
244 0.15
245 0.13
246 0.12
247 0.09
248 0.09
249 0.1
250 0.12
251 0.18
252 0.2
253 0.27
254 0.3
255 0.36
256 0.42
257 0.47
258 0.48
259 0.45
260 0.44
261 0.41
262 0.42
263 0.42
264 0.39
265 0.35
266 0.32