Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UNB8

Protein Details
Accession A0A286UNB8    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
57-78IKYIRRAWKRVSKATRKPERASHydrophilic
NLS Segment(s)
PositionSequence
61-73RRAWKRVSKATRK
Subcellular Location(s) mito 14, nucl 10, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MNTLHVAHSNASYLTTTGSVSSSRCSSALSYYLSDTSSTTSSSVSKPSRTAAAKLYIKYIRRAWKRVSKATRKPERASVLPEGFIIISNANANFNSKRKSILFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.09
5 0.1
6 0.1
7 0.1
8 0.13
9 0.13
10 0.14
11 0.13
12 0.14
13 0.14
14 0.15
15 0.18
16 0.17
17 0.16
18 0.16
19 0.17
20 0.16
21 0.16
22 0.13
23 0.12
24 0.11
25 0.1
26 0.09
27 0.1
28 0.11
29 0.11
30 0.18
31 0.18
32 0.19
33 0.19
34 0.2
35 0.25
36 0.25
37 0.25
38 0.22
39 0.27
40 0.29
41 0.28
42 0.32
43 0.3
44 0.3
45 0.33
46 0.36
47 0.37
48 0.4
49 0.45
50 0.48
51 0.53
52 0.59
53 0.65
54 0.69
55 0.7
56 0.74
57 0.8
58 0.83
59 0.81
60 0.77
61 0.75
62 0.71
63 0.64
64 0.6
65 0.57
66 0.48
67 0.41
68 0.37
69 0.3
70 0.24
71 0.21
72 0.16
73 0.09
74 0.08
75 0.09
76 0.09
77 0.1
78 0.1
79 0.14
80 0.18
81 0.24
82 0.27
83 0.27
84 0.32