Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UMY1

Protein Details
Accession A0A286UMY1   
Localization Confidence High
Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-51MPRIRKKTSKRGTTHQRRKVHQKVTESRKKSKKEAKKNTQWKSKQNKDPGIBasic
72-101DEEERQQRKEQRKAEKLKKKEEESKTKTKABasic
NLS Segment(s)
PositionSequence
3-44RIRKKTSKRGTTHQRRKVHQKVTESRKKSKKEAKKNTQWKSK
74-102EERQQRKEQRKAEKLKKKEEESKTKTKAK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014813  Gnl3_N_dom  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
Amino Acid Sequences MPRIRKKTSKRGTTHQRRKVHQKVTESRKKSKKEAKKNTQWKSKQNKDPGIPNNFPYKDRILAEIAEQRRRDEEERQQRKEQRKAEKLKKKEEESKTKTKAKAEASDEDEAEEEDEADE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.86
4 0.84
5 0.88
6 0.87
7 0.85
8 0.81
9 0.8
10 0.81
11 0.82
12 0.84
13 0.8
14 0.8
15 0.79
16 0.78
17 0.78
18 0.78
19 0.78
20 0.79
21 0.84
22 0.85
23 0.87
24 0.92
25 0.91
26 0.91
27 0.88
28 0.86
29 0.86
30 0.85
31 0.83
32 0.81
33 0.79
34 0.72
35 0.73
36 0.71
37 0.68
38 0.59
39 0.52
40 0.51
41 0.45
42 0.42
43 0.36
44 0.31
45 0.26
46 0.25
47 0.25
48 0.18
49 0.17
50 0.18
51 0.22
52 0.23
53 0.25
54 0.25
55 0.23
56 0.24
57 0.27
58 0.28
59 0.28
60 0.36
61 0.42
62 0.51
63 0.56
64 0.63
65 0.67
66 0.74
67 0.76
68 0.74
69 0.73
70 0.74
71 0.79
72 0.81
73 0.84
74 0.83
75 0.85
76 0.85
77 0.82
78 0.82
79 0.82
80 0.82
81 0.8
82 0.82
83 0.8
84 0.79
85 0.76
86 0.71
87 0.68
88 0.64
89 0.64
90 0.59
91 0.58
92 0.55
93 0.54
94 0.49
95 0.42
96 0.36
97 0.27
98 0.23
99 0.16