Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286UJX8

Protein Details
Accession A0A286UJX8    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
44-68EAAKYFKPKQHREGRSRNSHLIKKRBasic
NLS Segment(s)
PositionSequence
55-60REGRSR
Subcellular Location(s) cyto 14, cyto_nucl 10.333, cyto_mito 9.833, nucl 5.5, mito 4.5
Family & Domain DBs
Amino Acid Sequences MRVNVSALTFGWVDDLTIHACKSDVTGFRLLLGNIAHEFCVIHEAAKYFKPKQHREGRSRNSHLIKKRLAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.1
5 0.1
6 0.09
7 0.09
8 0.09
9 0.1
10 0.14
11 0.14
12 0.16
13 0.19
14 0.19
15 0.2
16 0.21
17 0.19
18 0.16
19 0.13
20 0.11
21 0.09
22 0.09
23 0.08
24 0.07
25 0.07
26 0.05
27 0.07
28 0.06
29 0.06
30 0.07
31 0.07
32 0.09
33 0.13
34 0.18
35 0.19
36 0.23
37 0.33
38 0.39
39 0.48
40 0.57
41 0.63
42 0.69
43 0.77
44 0.83
45 0.84
46 0.85
47 0.84
48 0.82
49 0.81
50 0.8
51 0.78