Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286UUU6

Protein Details
Accession A0A286UUU6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-40PWKLSVTRKANQRKRLKQVDAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 11.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGAFRPSHVSLSGLLWKTPWKLSVTRKANQRKRLKQVDAVIEAVRASGVKCSALDKALLLPKESEMPAKDKYTVFSSWDKGYRKGIHKVPKFTRLTLRTNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.21
4 0.23
5 0.25
6 0.25
7 0.24
8 0.21
9 0.27
10 0.35
11 0.45
12 0.48
13 0.51
14 0.59
15 0.67
16 0.72
17 0.76
18 0.78
19 0.77
20 0.8
21 0.84
22 0.79
23 0.74
24 0.72
25 0.68
26 0.59
27 0.51
28 0.41
29 0.32
30 0.27
31 0.2
32 0.14
33 0.08
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.07
40 0.07
41 0.08
42 0.08
43 0.07
44 0.1
45 0.13
46 0.13
47 0.13
48 0.13
49 0.13
50 0.15
51 0.15
52 0.14
53 0.13
54 0.16
55 0.19
56 0.2
57 0.22
58 0.2
59 0.22
60 0.24
61 0.23
62 0.24
63 0.24
64 0.26
65 0.27
66 0.34
67 0.34
68 0.34
69 0.4
70 0.44
71 0.47
72 0.52
73 0.56
74 0.6
75 0.65
76 0.72
77 0.71
78 0.73
79 0.71
80 0.67
81 0.69
82 0.65
83 0.65
84 0.64
85 0.68