Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UU73

Protein Details
Accession A0A286UU73    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
96-115ATRYHKVKFFERKKVLRKISHydrophilic
250-282LKTMSLKQTKDQKSRKQGKEKLKETKSKPDHTVHydrophilic
NLS Segment(s)
PositionSequence
262-273KSRKQGKEKLKE
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MGPIRTGSSGKQQPKNSGTLRRSNTGSFHGHGKQRSSSDIELPGVQKLKSALRQTKRLLAKDNLSADVRVKTDRRLKSLEADLEASESKRKERTLATRYHKVKFFERKKVLRKISQVKNDLEAASENRSASAKEAATQLENTLFELRVDLNYILHFPKLEKYISLFPSSDSKSNESRNSDDGENNAGSTSINETDSRRAQLRAFVRSQMEAGELGCEPELDIELRSKEESVGHPGTSLTIASVGMDRTKLKTMSLKQTKDQKSRKQGKEKLKETKSKPDHTVIDDFFAVGSDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.67
4 0.68
5 0.65
6 0.67
7 0.66
8 0.63
9 0.62
10 0.56
11 0.53
12 0.48
13 0.46
14 0.38
15 0.39
16 0.41
17 0.43
18 0.45
19 0.45
20 0.45
21 0.43
22 0.45
23 0.44
24 0.4
25 0.38
26 0.38
27 0.35
28 0.33
29 0.31
30 0.31
31 0.28
32 0.25
33 0.22
34 0.21
35 0.25
36 0.29
37 0.38
38 0.43
39 0.47
40 0.56
41 0.58
42 0.64
43 0.66
44 0.63
45 0.61
46 0.57
47 0.54
48 0.53
49 0.52
50 0.46
51 0.4
52 0.36
53 0.31
54 0.29
55 0.26
56 0.24
57 0.22
58 0.27
59 0.35
60 0.38
61 0.41
62 0.43
63 0.44
64 0.45
65 0.5
66 0.45
67 0.38
68 0.35
69 0.3
70 0.27
71 0.26
72 0.2
73 0.18
74 0.16
75 0.17
76 0.19
77 0.2
78 0.21
79 0.28
80 0.37
81 0.4
82 0.49
83 0.54
84 0.6
85 0.64
86 0.66
87 0.63
88 0.57
89 0.58
90 0.6
91 0.6
92 0.62
93 0.66
94 0.7
95 0.74
96 0.8
97 0.79
98 0.74
99 0.75
100 0.75
101 0.74
102 0.74
103 0.7
104 0.62
105 0.57
106 0.52
107 0.42
108 0.33
109 0.25
110 0.18
111 0.16
112 0.16
113 0.13
114 0.12
115 0.12
116 0.12
117 0.12
118 0.13
119 0.1
120 0.11
121 0.12
122 0.12
123 0.13
124 0.13
125 0.12
126 0.1
127 0.1
128 0.09
129 0.09
130 0.08
131 0.07
132 0.08
133 0.08
134 0.06
135 0.08
136 0.07
137 0.06
138 0.06
139 0.08
140 0.08
141 0.08
142 0.08
143 0.07
144 0.1
145 0.12
146 0.12
147 0.11
148 0.13
149 0.19
150 0.21
151 0.22
152 0.2
153 0.18
154 0.24
155 0.25
156 0.26
157 0.22
158 0.24
159 0.26
160 0.31
161 0.35
162 0.33
163 0.34
164 0.32
165 0.33
166 0.31
167 0.27
168 0.24
169 0.22
170 0.19
171 0.16
172 0.14
173 0.11
174 0.09
175 0.09
176 0.1
177 0.08
178 0.09
179 0.1
180 0.12
181 0.16
182 0.19
183 0.21
184 0.21
185 0.21
186 0.21
187 0.27
188 0.3
189 0.31
190 0.31
191 0.32
192 0.32
193 0.3
194 0.3
195 0.23
196 0.2
197 0.14
198 0.12
199 0.1
200 0.08
201 0.08
202 0.08
203 0.07
204 0.06
205 0.06
206 0.07
207 0.06
208 0.07
209 0.09
210 0.1
211 0.11
212 0.12
213 0.12
214 0.12
215 0.15
216 0.16
217 0.21
218 0.23
219 0.21
220 0.21
221 0.21
222 0.2
223 0.18
224 0.16
225 0.08
226 0.07
227 0.06
228 0.07
229 0.08
230 0.08
231 0.08
232 0.1
233 0.12
234 0.14
235 0.19
236 0.19
237 0.21
238 0.28
239 0.35
240 0.44
241 0.52
242 0.54
243 0.57
244 0.67
245 0.74
246 0.76
247 0.79
248 0.78
249 0.79
250 0.86
251 0.89
252 0.9
253 0.89
254 0.9
255 0.91
256 0.9
257 0.9
258 0.88
259 0.88
260 0.83
261 0.85
262 0.83
263 0.8
264 0.76
265 0.74
266 0.69
267 0.65
268 0.67
269 0.57
270 0.51
271 0.43
272 0.37
273 0.29
274 0.24