Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UKL8

Protein Details
Accession A0A286UKL8   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
123-142VQTKGQRRANPFRERKRFDAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020095  PsdUridine_synth_TruA_C  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
Amino Acid Sequences MAVRTGTPPSLIDSLYGKQSVTIPKMPSLGLLLEHPIFESYSKRIATANEKLDPSHPDYRNPIDFDVHKAEIERFKEEHIYRRMRESEDKVEVFDRWLSLFDRYTGSDLLYFNSQGNIPPEAVQTKGQRRANPFRERKRFDATEFAADASAAAEEAKDVAEEATPAETDDVDEEEAMNKKELEEAEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.22
4 0.18
5 0.17
6 0.21
7 0.26
8 0.28
9 0.31
10 0.3
11 0.32
12 0.34
13 0.32
14 0.28
15 0.24
16 0.19
17 0.15
18 0.13
19 0.14
20 0.13
21 0.13
22 0.12
23 0.11
24 0.11
25 0.11
26 0.13
27 0.12
28 0.17
29 0.18
30 0.18
31 0.19
32 0.22
33 0.28
34 0.33
35 0.36
36 0.35
37 0.35
38 0.35
39 0.36
40 0.36
41 0.35
42 0.37
43 0.33
44 0.32
45 0.37
46 0.41
47 0.43
48 0.41
49 0.36
50 0.3
51 0.29
52 0.31
53 0.31
54 0.26
55 0.22
56 0.21
57 0.22
58 0.24
59 0.25
60 0.24
61 0.19
62 0.19
63 0.26
64 0.27
65 0.32
66 0.35
67 0.39
68 0.36
69 0.41
70 0.43
71 0.39
72 0.43
73 0.4
74 0.38
75 0.37
76 0.36
77 0.32
78 0.3
79 0.27
80 0.23
81 0.18
82 0.12
83 0.08
84 0.09
85 0.09
86 0.09
87 0.1
88 0.1
89 0.11
90 0.11
91 0.12
92 0.11
93 0.11
94 0.11
95 0.11
96 0.11
97 0.11
98 0.11
99 0.09
100 0.1
101 0.1
102 0.09
103 0.11
104 0.11
105 0.11
106 0.11
107 0.12
108 0.12
109 0.14
110 0.17
111 0.22
112 0.28
113 0.36
114 0.4
115 0.43
116 0.5
117 0.59
118 0.64
119 0.68
120 0.71
121 0.73
122 0.8
123 0.81
124 0.78
125 0.76
126 0.71
127 0.63
128 0.62
129 0.54
130 0.48
131 0.43
132 0.38
133 0.29
134 0.25
135 0.22
136 0.13
137 0.1
138 0.05
139 0.04
140 0.03
141 0.03
142 0.04
143 0.04
144 0.04
145 0.04
146 0.05
147 0.05
148 0.05
149 0.06
150 0.07
151 0.07
152 0.08
153 0.08
154 0.07
155 0.08
156 0.09
157 0.1
158 0.09
159 0.09
160 0.09
161 0.12
162 0.16
163 0.16
164 0.17
165 0.15
166 0.15
167 0.19