Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8C1F6

Protein Details
Accession G8C1F6   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-31GEQHRVARYRRRDVRNLDNKLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 7, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003723  F:RNA binding  
GO:0051028  P:mRNA transport  
KEGG tpf:TPHA_0O00120  -  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MDDISENKPGEQHRVARYRRRDVRNLDNKLGFRGQAEEPVKKRVKFSNLPVDVSDFTVEDMVKEFGTPVFSRFYEYKDGRTAVFELETPGAMEKVVEKYNDFEINGSKIAVEMFDLRQRKPKSSFTPVYARGSRGSHYAEIREQPFTSNKSSHGSRKKATQPAKPTVEELDAELEAYMKST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.65
4 0.72
5 0.75
6 0.79
7 0.8
8 0.79
9 0.78
10 0.82
11 0.82
12 0.8
13 0.77
14 0.72
15 0.65
16 0.61
17 0.55
18 0.44
19 0.34
20 0.31
21 0.24
22 0.27
23 0.31
24 0.33
25 0.33
26 0.42
27 0.47
28 0.45
29 0.48
30 0.46
31 0.51
32 0.5
33 0.56
34 0.57
35 0.54
36 0.54
37 0.51
38 0.47
39 0.39
40 0.33
41 0.26
42 0.15
43 0.12
44 0.12
45 0.11
46 0.08
47 0.08
48 0.08
49 0.07
50 0.07
51 0.07
52 0.06
53 0.1
54 0.1
55 0.1
56 0.12
57 0.12
58 0.15
59 0.16
60 0.18
61 0.23
62 0.24
63 0.26
64 0.26
65 0.27
66 0.24
67 0.25
68 0.23
69 0.15
70 0.14
71 0.11
72 0.09
73 0.09
74 0.08
75 0.07
76 0.06
77 0.06
78 0.05
79 0.05
80 0.05
81 0.07
82 0.09
83 0.09
84 0.09
85 0.11
86 0.14
87 0.15
88 0.14
89 0.12
90 0.12
91 0.13
92 0.13
93 0.12
94 0.09
95 0.08
96 0.07
97 0.07
98 0.06
99 0.06
100 0.07
101 0.13
102 0.15
103 0.16
104 0.25
105 0.27
106 0.32
107 0.36
108 0.43
109 0.45
110 0.53
111 0.56
112 0.53
113 0.59
114 0.58
115 0.59
116 0.53
117 0.47
118 0.4
119 0.38
120 0.34
121 0.29
122 0.28
123 0.25
124 0.25
125 0.26
126 0.27
127 0.31
128 0.31
129 0.31
130 0.27
131 0.27
132 0.29
133 0.3
134 0.31
135 0.27
136 0.28
137 0.31
138 0.36
139 0.43
140 0.48
141 0.52
142 0.51
143 0.59
144 0.65
145 0.7
146 0.73
147 0.72
148 0.71
149 0.74
150 0.76
151 0.68
152 0.61
153 0.55
154 0.49
155 0.4
156 0.33
157 0.27
158 0.2
159 0.19
160 0.16
161 0.13