Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UDW4

Protein Details
Accession A0A286UDW4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-37LDLTKLPRARRLRSVRFRRTTPGKAHydrophilic
NLS Segment(s)
PositionSequence
22-28RRLRSVR
Subcellular Location(s) mito 14, nucl 8, cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MTSLPCNTERLLLDLTKLPRARRLRSVRFRRTTPGKASRLITPFIASKNDRILDPKHPAAKVPLSQFVHKQVPSFRDHSASSLLGIRAFPKALLEKNEFAWLQEDWPYKARGKSNYFVMDGGKSKDGNKAGGADVSKGYEQVRVLGGAKRVNMSVLFVISKKLVHKDACVRTRIKNRIKSALSLLITRDVEVAPSVSNTSSEQDSSKQETTLVSTGTDDGEKWIMQDWVYIFYPKLDVYRAPFNEIVSSLRLGLGYVNKRCRELETFWSSGRSTSGSILYSGSRIIKGRVVKFKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.34
4 0.37
5 0.35
6 0.4
7 0.48
8 0.51
9 0.55
10 0.63
11 0.66
12 0.74
13 0.83
14 0.85
15 0.85
16 0.82
17 0.82
18 0.8
19 0.77
20 0.77
21 0.76
22 0.7
23 0.67
24 0.66
25 0.63
26 0.58
27 0.51
28 0.42
29 0.34
30 0.32
31 0.29
32 0.34
33 0.28
34 0.27
35 0.32
36 0.32
37 0.3
38 0.32
39 0.33
40 0.34
41 0.4
42 0.43
43 0.42
44 0.41
45 0.42
46 0.43
47 0.45
48 0.43
49 0.39
50 0.42
51 0.39
52 0.41
53 0.42
54 0.43
55 0.43
56 0.39
57 0.38
58 0.35
59 0.36
60 0.38
61 0.38
62 0.34
63 0.31
64 0.31
65 0.3
66 0.27
67 0.23
68 0.2
69 0.2
70 0.18
71 0.15
72 0.15
73 0.14
74 0.12
75 0.12
76 0.11
77 0.1
78 0.13
79 0.15
80 0.21
81 0.24
82 0.24
83 0.25
84 0.29
85 0.26
86 0.23
87 0.22
88 0.17
89 0.14
90 0.19
91 0.19
92 0.17
93 0.19
94 0.22
95 0.23
96 0.27
97 0.3
98 0.32
99 0.36
100 0.37
101 0.41
102 0.41
103 0.39
104 0.36
105 0.32
106 0.27
107 0.23
108 0.22
109 0.18
110 0.15
111 0.15
112 0.2
113 0.2
114 0.18
115 0.17
116 0.17
117 0.15
118 0.17
119 0.16
120 0.12
121 0.11
122 0.11
123 0.11
124 0.1
125 0.1
126 0.09
127 0.09
128 0.09
129 0.09
130 0.09
131 0.1
132 0.12
133 0.14
134 0.13
135 0.14
136 0.13
137 0.13
138 0.13
139 0.11
140 0.1
141 0.08
142 0.07
143 0.07
144 0.07
145 0.08
146 0.07
147 0.09
148 0.09
149 0.12
150 0.15
151 0.16
152 0.19
153 0.27
154 0.35
155 0.38
156 0.41
157 0.41
158 0.44
159 0.53
160 0.59
161 0.59
162 0.59
163 0.59
164 0.64
165 0.63
166 0.57
167 0.52
168 0.48
169 0.4
170 0.33
171 0.29
172 0.25
173 0.23
174 0.21
175 0.18
176 0.12
177 0.11
178 0.1
179 0.1
180 0.06
181 0.06
182 0.07
183 0.06
184 0.07
185 0.08
186 0.1
187 0.1
188 0.11
189 0.12
190 0.14
191 0.18
192 0.22
193 0.22
194 0.21
195 0.21
196 0.2
197 0.23
198 0.21
199 0.18
200 0.13
201 0.12
202 0.13
203 0.13
204 0.12
205 0.09
206 0.09
207 0.1
208 0.09
209 0.09
210 0.1
211 0.1
212 0.1
213 0.12
214 0.11
215 0.14
216 0.15
217 0.16
218 0.14
219 0.14
220 0.16
221 0.14
222 0.15
223 0.13
224 0.14
225 0.18
226 0.27
227 0.28
228 0.31
229 0.31
230 0.3
231 0.3
232 0.29
233 0.27
234 0.19
235 0.19
236 0.14
237 0.13
238 0.13
239 0.11
240 0.13
241 0.18
242 0.24
243 0.31
244 0.39
245 0.4
246 0.43
247 0.44
248 0.47
249 0.45
250 0.42
251 0.44
252 0.43
253 0.45
254 0.43
255 0.46
256 0.41
257 0.36
258 0.32
259 0.25
260 0.19
261 0.18
262 0.2
263 0.18
264 0.18
265 0.19
266 0.18
267 0.16
268 0.17
269 0.17
270 0.17
271 0.18
272 0.2
273 0.24
274 0.31
275 0.39