Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BUX2

Protein Details
Accession G8BUX2   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
163-185VRKVIVCKKCNSKFKGQNRLRMLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13.333, mito_nucl 11.499, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013895  Rsc14  
Gene Ontology GO:0016586  C:RSC-type complex  
GO:0006338  P:chromatin remodeling  
KEGG tpf:TPHA_0F00680  -  
Pfam View protein in Pfam  
PF08586  Rsc14  
Amino Acid Sequences MQKMEGTQKKNYYDVIAGLSAFEKSNEVTLSIQELEELTSTKKDDTEKDNVDSITKKKILQEDEKKSKMIVHGYLGGKVDLSHASNATYDLSHCLLGGFVPKPQLETLSSVDFANYFHRSLECENALEVYDFLVGNEYRHVQQQQLKQNQDSEGYKSKNENAVRKVIVCKKCNSKFKGQNRLRMLYNHICNSKINK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.23
4 0.2
5 0.18
6 0.17
7 0.14
8 0.12
9 0.11
10 0.09
11 0.08
12 0.11
13 0.11
14 0.12
15 0.12
16 0.12
17 0.15
18 0.14
19 0.14
20 0.11
21 0.11
22 0.1
23 0.1
24 0.1
25 0.09
26 0.1
27 0.11
28 0.12
29 0.14
30 0.16
31 0.21
32 0.25
33 0.33
34 0.35
35 0.36
36 0.39
37 0.36
38 0.36
39 0.35
40 0.31
41 0.3
42 0.28
43 0.27
44 0.28
45 0.34
46 0.38
47 0.44
48 0.52
49 0.55
50 0.62
51 0.63
52 0.59
53 0.54
54 0.5
55 0.42
56 0.36
57 0.27
58 0.2
59 0.25
60 0.25
61 0.27
62 0.25
63 0.21
64 0.17
65 0.15
66 0.14
67 0.09
68 0.09
69 0.08
70 0.08
71 0.09
72 0.09
73 0.09
74 0.08
75 0.07
76 0.06
77 0.08
78 0.08
79 0.08
80 0.07
81 0.07
82 0.06
83 0.06
84 0.08
85 0.07
86 0.07
87 0.09
88 0.09
89 0.1
90 0.1
91 0.12
92 0.1
93 0.13
94 0.14
95 0.13
96 0.14
97 0.13
98 0.13
99 0.12
100 0.11
101 0.12
102 0.12
103 0.11
104 0.1
105 0.11
106 0.13
107 0.14
108 0.18
109 0.15
110 0.14
111 0.13
112 0.13
113 0.14
114 0.12
115 0.1
116 0.07
117 0.07
118 0.06
119 0.06
120 0.08
121 0.08
122 0.08
123 0.1
124 0.11
125 0.11
126 0.15
127 0.16
128 0.18
129 0.24
130 0.32
131 0.4
132 0.47
133 0.5
134 0.49
135 0.51
136 0.48
137 0.46
138 0.4
139 0.36
140 0.36
141 0.34
142 0.35
143 0.35
144 0.38
145 0.41
146 0.45
147 0.47
148 0.43
149 0.48
150 0.47
151 0.47
152 0.51
153 0.52
154 0.55
155 0.52
156 0.55
157 0.59
158 0.67
159 0.73
160 0.71
161 0.73
162 0.75
163 0.81
164 0.84
165 0.81
166 0.81
167 0.8
168 0.78
169 0.71
170 0.64
171 0.62
172 0.6
173 0.6
174 0.58
175 0.53
176 0.49