Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286UMD5

Protein Details
Accession A0A286UMD5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-31SSGGKAKAKKKWSKGKEVPTFRFHydrophilic
NLS Segment(s)
PositionSequence
10-24SGGKAKAKKKWSKGK
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKVAASSGGKAKAKKKWSKGKEVPTFRFISQSILIERLKINGSLARIAIRHLAKEGQIKKIVHHSSQLIYTRTTGGGAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.54
4 0.59
5 0.65
6 0.69
7 0.73
8 0.8
9 0.82
10 0.84
11 0.84
12 0.85
13 0.79
14 0.73
15 0.68
16 0.57
17 0.51
18 0.41
19 0.34
20 0.26
21 0.23
22 0.19
23 0.19
24 0.19
25 0.17
26 0.16
27 0.14
28 0.13
29 0.12
30 0.11
31 0.1
32 0.11
33 0.1
34 0.11
35 0.11
36 0.1
37 0.11
38 0.16
39 0.15
40 0.14
41 0.15
42 0.16
43 0.17
44 0.26
45 0.28
46 0.28
47 0.34
48 0.34
49 0.35
50 0.44
51 0.45
52 0.38
53 0.39
54 0.36
55 0.32
56 0.38
57 0.41
58 0.33
59 0.3
60 0.3
61 0.28
62 0.25