Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286UFB1

Protein Details
Accession A0A286UFB1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-30IKSNNHRLPSNQRRRIRNRNIDYNLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MVIMIKSNNHRLPSNQRRRIRNRNIDYNLEQVHNNQSYVLSRAEPSSKACVQNISGYCSLSGDTHSDPVPLGVSADAGRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.65
3 0.69
4 0.75
5 0.83
6 0.88
7 0.88
8 0.88
9 0.84
10 0.85
11 0.82
12 0.78
13 0.71
14 0.65
15 0.55
16 0.45
17 0.37
18 0.28
19 0.29
20 0.23
21 0.21
22 0.15
23 0.14
24 0.14
25 0.15
26 0.15
27 0.09
28 0.09
29 0.1
30 0.12
31 0.12
32 0.14
33 0.17
34 0.2
35 0.21
36 0.21
37 0.22
38 0.22
39 0.27
40 0.26
41 0.26
42 0.23
43 0.22
44 0.21
45 0.2
46 0.19
47 0.13
48 0.13
49 0.11
50 0.12
51 0.14
52 0.14
53 0.14
54 0.13
55 0.14
56 0.13
57 0.1
58 0.1
59 0.07
60 0.09