Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286US24

Protein Details
Accession A0A286US24   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-46AASIPIVKKRTKKFKRHQSDRYKSVKESWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-51KKRTKKFKRHQSDRYKSVKESWRKPKGIDNRVRRRFKGQIAMP
Subcellular Location(s) mito_nucl 13.833, mito 13.5, nucl 13, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASIPIVKKRTKKFKRHQSDRYKSVKESWRKPKGIDNRVRRRFKGQIAMPKIGYGSNKKTRHLLPNGLKKFLVSNVRDVDILLMHNKSFAAEIAHNVSSRNRITILEKAKALGVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.86
3 0.91
4 0.93
5 0.94
6 0.94
7 0.94
8 0.92
9 0.9
10 0.84
11 0.75
12 0.73
13 0.71
14 0.69
15 0.69
16 0.71
17 0.71
18 0.69
19 0.68
20 0.69
21 0.7
22 0.71
23 0.71
24 0.71
25 0.72
26 0.8
27 0.84
28 0.77
29 0.74
30 0.7
31 0.66
32 0.64
33 0.59
34 0.59
35 0.58
36 0.58
37 0.51
38 0.44
39 0.39
40 0.31
41 0.27
42 0.22
43 0.24
44 0.31
45 0.33
46 0.34
47 0.38
48 0.4
49 0.45
50 0.45
51 0.47
52 0.45
53 0.53
54 0.54
55 0.52
56 0.47
57 0.4
58 0.36
59 0.32
60 0.31
61 0.22
62 0.25
63 0.25
64 0.26
65 0.25
66 0.24
67 0.2
68 0.13
69 0.13
70 0.1
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.07
78 0.09
79 0.09
80 0.11
81 0.15
82 0.16
83 0.16
84 0.17
85 0.18
86 0.2
87 0.2
88 0.2
89 0.17
90 0.18
91 0.22
92 0.29
93 0.34
94 0.33
95 0.32
96 0.31
97 0.33
98 0.32
99 0.29
100 0.26
101 0.22
102 0.21
103 0.25
104 0.3
105 0.29
106 0.29
107 0.33
108 0.3