Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UGU9

Protein Details
Accession A0A286UGU9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MVWGMRQMRRRRRRKSGDATIHTHAHydrophilic
NLS Segment(s)
PositionSequence
9-15RRRRRRK
Subcellular Location(s) mito 19, mito_nucl 12.5, nucl 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MVWGMRQMRRRRRRKSGDATIHTHAHNVQCTSFFPLMIKANSSPADLSQFLGEEWWWKDKKARVELPVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.91
4 0.91
5 0.86
6 0.81
7 0.74
8 0.67
9 0.56
10 0.46
11 0.37
12 0.29
13 0.25
14 0.21
15 0.17
16 0.15
17 0.16
18 0.2
19 0.17
20 0.15
21 0.13
22 0.14
23 0.16
24 0.16
25 0.16
26 0.12
27 0.15
28 0.16
29 0.16
30 0.13
31 0.12
32 0.15
33 0.14
34 0.14
35 0.11
36 0.11
37 0.1
38 0.1
39 0.1
40 0.1
41 0.12
42 0.19
43 0.19
44 0.2
45 0.27
46 0.33
47 0.43
48 0.49
49 0.54