Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286U752

Protein Details
Accession A0A286U752    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSPERSYLKPTTKRIKKERSCIPVFKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 6, cyto_nucl 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MSPERSYLKPTTKRIKKERSCIPVFKNLIISSSSEWQRRQFGAYYASQDIFWCLIYYYSWSGQAQDFASPHFSGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.84
4 0.84
5 0.85
6 0.83
7 0.81
8 0.78
9 0.72
10 0.7
11 0.63
12 0.54
13 0.48
14 0.39
15 0.33
16 0.27
17 0.24
18 0.16
19 0.2
20 0.22
21 0.21
22 0.23
23 0.24
24 0.26
25 0.25
26 0.25
27 0.21
28 0.2
29 0.2
30 0.2
31 0.21
32 0.2
33 0.2
34 0.18
35 0.17
36 0.16
37 0.13
38 0.12
39 0.08
40 0.07
41 0.07
42 0.07
43 0.1
44 0.12
45 0.13
46 0.15
47 0.15
48 0.17
49 0.17
50 0.2
51 0.18
52 0.19
53 0.18
54 0.17
55 0.21