Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UTQ9

Protein Details
Accession A0A286UTQ9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
104-123VTTCRRLFSRIRRVKTKSYEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 7, E.R. 3, golg 3, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPMRPFDVYVHPDFKYQPFESYHGSTILAHSMPVLIIGGAAFTILASSSNTLMNMPLLLFPFFAFTSIPIFFLLQSSFLTIFHKPTIPYSTLSPLAYRFGSVRVTTCRRLFSRIRRVKTKSYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.32
4 0.31
5 0.3
6 0.33
7 0.36
8 0.37
9 0.35
10 0.28
11 0.27
12 0.23
13 0.21
14 0.2
15 0.15
16 0.11
17 0.09
18 0.09
19 0.07
20 0.07
21 0.06
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.02
29 0.02
30 0.02
31 0.02
32 0.03
33 0.03
34 0.04
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.06
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.09
54 0.09
55 0.09
56 0.08
57 0.08
58 0.08
59 0.09
60 0.09
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.1
67 0.1
68 0.12
69 0.12
70 0.14
71 0.13
72 0.16
73 0.2
74 0.2
75 0.21
76 0.21
77 0.24
78 0.25
79 0.25
80 0.23
81 0.2
82 0.21
83 0.19
84 0.18
85 0.14
86 0.14
87 0.17
88 0.17
89 0.19
90 0.25
91 0.3
92 0.36
93 0.38
94 0.43
95 0.42
96 0.48
97 0.54
98 0.57
99 0.62
100 0.66
101 0.71
102 0.74
103 0.79